"INSR" Related Products

Expand
Expand

Recombinant Human INSR Protein, GST-tagged

Cat.No.: INSR-5092H
Product Overview: Human INSR partial ORF ( NP_000199, 881 a.a. - 980 a.a.) recombinant protein with GST-tag at N-terminal.
Description: After removal of the precursor signal peptide, the insulin receptor precursor is post-translationally cleaved into two chains (alpha and beta) that are covalently linked. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Source: Wheat Germ
Species: Human
Tag : GST
Molecular Mass: 36.63 kDa
AA Sequence: IVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLR
Applications: Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: INSR insulin receptor [ Homo sapiens ]
Official Symbol: INSR
Synonyms: INSR; insulin receptor; CD220; IR; HHF5;
Gene ID: 3643
mRNA Refseq: NM_000208
Protein Refseq: NP_000199
MIM: 147670
UniProt ID: P06213

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.