Recombinant Human INSR Protein, GST-tagged

Cat.No. : INSR-5092H
Product Overview : Human INSR partial ORF ( NP_000199, 881 a.a. - 980 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : After removal of the precursor signal peptide, the insulin receptor precursor is post-translationally cleaved into two chains (alpha and beta) that are covalently linked. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 36.63 kDa
AA Sequence : IVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name INSR insulin receptor [ Homo sapiens ]
Official Symbol INSR
Synonyms INSR; insulin receptor; CD220; IR; HHF5;
Gene ID 3643
mRNA Refseq NM_000208
Protein Refseq NP_000199
MIM 147670
UniProt ID P06213

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All INSR Products

Required fields are marked with *

My Review for All INSR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon