Recombinant Human INSR protein(601-750 aa), C-His-tagged
Cat.No. : | INSR-2564H |
Product Overview : | Recombinant Human INSR protein(P06213)(601-750 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 601-750 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSDPNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRKTSSGT |
Gene Name | INSR insulin receptor [ Homo sapiens ] |
Official Symbol | INSR |
Synonyms | INSR; insulin receptor; CD220; IR; HHF5; |
Gene ID | 3643 |
mRNA Refseq | NM_000208 |
Protein Refseq | NP_000199 |
MIM | 147670 |
UniProt ID | P06213 |
◆ Recombinant Proteins | ||
INSR-29493TH | Recombinant Human INSR | +Inquiry |
INSR-622H | Recombinant Human INSR, His tagged | +Inquiry |
INSR-611H | Recombinant Human Insulin Receptor, Fc Chimera | +Inquiry |
INSR-7893H | Recombinant Human INSR protein, His-tagged | +Inquiry |
INSR-1260H | Recombinant Human INSR Protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
INSR-474HCL | Recombinant Human INSR cell lysate | +Inquiry |
INSR-2648HCL | Recombinant Human INSR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All INSR Products
Required fields are marked with *
My Review for All INSR Products
Required fields are marked with *