Recombinant Human insulin like growth factor 1 receptor Protein, His tagged
| Cat.No. : | IGF1R-001H |
| Product Overview : | Recombinant Human IGF1R Protein with His tag was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 741-935 aa |
| Description : | This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Tag : | C-His |
| Molecular Mass : | 24 kDa |
| AA Sequence : | MDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHHHHHHHHH |
| Endotoxin : | < 1 EU/μg by LAL |
| Purity : | > 90% by SDS-PAGE |
| Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
| Concentration : | 1 mg/mL by Bradford |
| Gene Name | IGF1R insulin like growth factor 1 receptor [ Homo sapiens (human) ] |
| Official Symbol | IGF1R |
| Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172 |
| Gene ID | 3480 |
| mRNA Refseq | NM_000875 |
| Protein Refseq | NP_000866 |
| MIM | 147370 |
| UniProt ID | P08069 |
| ◆ Recombinant Proteins | ||
| IGF1R-3148HF | Recombinant Human IGF1R Protein, His-tagged, FITC conjugated | +Inquiry |
| IGF1R-169H | Recombinant Human IGF1R protein, His-Avi-tagged | +Inquiry |
| IGF1R-330H | Recombinant Human Insulin-like Growth Factor 1 Receptor, His-tagged, Active | +Inquiry |
| IGF1R-214H | Recombinant Human IGF1R protein, DDK/His-tagged | +Inquiry |
| IGF1R-001H | Recombinant Human insulin like growth factor 1 receptor Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *
