Recombinant Human insulin like growth factor 1 receptor Protein, His tagged
Cat.No. : | IGF1R-001H |
Product Overview : | Recombinant Human IGF1R Protein with His tag was expressed in E. coli. |
Availability | June 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 741-935 aa |
Description : | This receptor binds insulin-like growth factor with a high affinity. It has tyrosine kinase activity. The insulin-like growth factor I receptor plays a critical role in transformation events. Cleavage of the precursor generates alpha and beta subunits. It is highly overexpressed in most malignant tissues where it functions as an anti-apoptotic agent by enhancing cell survival. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Tag : | C-His |
Molecular Mass : | 24 kDa |
AA Sequence : | MDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFESRVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTWEPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGNYTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHHHHHHHHH |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Concentration : | 1 mg/mL by Bradford |
Gene Name | IGF1R insulin like growth factor 1 receptor [ Homo sapiens (human) ] |
Official Symbol | IGF1R |
Synonyms | IGF1R; insulin-like growth factor 1 receptor; CD221; IGFIR; IGFR; JTK13; MGC18216; IGF-I receptor; soluble IGF1R variant 1; soluble IGF1R variant 2; insulin-like growth factor I receptor; MGC142170; MGC142172 |
Gene ID | 3480 |
mRNA Refseq | NM_000875 |
Protein Refseq | NP_000866 |
MIM | 147370 |
UniProt ID | P08069 |
◆ Recombinant Proteins | ||
IGF1R-29115TH | Recombinant Human IGF1R, His-tagged | +Inquiry |
IGF1R-50C | Recombinant Canine IGF1R Protein, His-tagged | +Inquiry |
IGF1R-391H | Recombinant Cynomolgus IGF1R protein, His-tagged | +Inquiry |
IGF1R-50H | Active Recombinant Human IGF1R protein, His&GST-tagged | +Inquiry |
IGF1R-0286H | Recombinant Human IGF1R protein, His-Avi-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
IGF1R-2928HCL | Recombinant Human IGF1R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IGF1R Products
Required fields are marked with *
My Review for All IGF1R Products
Required fields are marked with *
0
Inquiry Basket