Recombinant Human Interleukin 10 Receptor, Alpha, Fc Chimera
Cat.No. : | IL10RA-492H |
Product Overview : | Recombinant Human interleukin 10 receptor, alpha encoding the signal peptide of IL-10 receptor alpha chain was fused to the extracellular domain of human CD209L (aa 1-328), which was in turn fused to the Fc region of human IgG1 (aa 93-330). The chimeric protein was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 1-328 a.a. |
Description : | Interleukin 10 Receptor, Alpha, a member of the 'SIGN' family of C-type lectin receptors, is a type II membrane protein that is expressed on liver sinusoidal endothelial cells (LSEC), specialized capillary vessels that are involved in antigen presentation and hepatic immune surveillance. CD209L is also expressed by endothelial cells associated with lymph nodes and in the human lung on type II alveolar cells and endothelial cells. |
Amino Acid Sequence : | HGTELPSPPSKLQVSKVPSSLSQEQSEQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTELKAAVGELPEKSKLQEIYQELTQLKAAVGELPDQSKQQQIYQELTDLKTAFERLCRHCPKDWTFFQGNCYFMSNSQRNWHDSVTACQEVRAQLVVIKTAEEQNFLQLQTSRSNRFSWMGLSDLNQEGTWQWVDGSPLSPSFQRYWNSGEPNNSGNEDCAEFSGSGWNDNRCDVDNYWICKKPAACFRDGIPKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK. |
Molecular Mass : | Interleukin 10 Receptor, Alpha Chimera migrates as a broad band between 70 and 85 kDa in SDS-PAGE due to post-translation modifications, in particular glycosylation. |
pI : | Interleukin 10 Receptor, Alpha Chimera separates into a number of isoforms in 2D PAGE due to post-translational modifications, in particular glycosylation. The pI range is between 5.4 and 6.5. |
% Carbohydrate : | Interleukin 10 Receptor, Alpha Chimera consists of 5-25% carbohydrate by weight. |
Glycosylation : | Interleukin 10 Receptor, Alpha Chimera has N-linked and may have O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : | The product is supplied as a 200ug/ml solution in sterile phosphate-buffered saline. |
Storage : | Short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Gene Name | IL10RA interleukin 10 receptor, alpha [ Homo sapiens ] |
Synonyms | IL10RA; interleukin 10 receptor, alpha; IL10R; CDW210A; HIL-10R; IL-10R1;Interleukin-10 receptor alpha chain;IL-10R-A; interleukin 10 receptor, alpha; CDw210a antigen |
Gene ID | 3587 |
mRNA Refseq | NM_001558 |
Protein Refseq | NP_001549 |
UniProt ID | Q13651 |
Chromosome Location | 11q23 |
MIM | 146933 |
Pathway | Cytokine-cytokine receptor interaction; Jak-STAT signaling pathway |
Function | interleukin-10 receptor activity; protein binding; receptor activity |
◆ Recombinant Proteins | ||
IL10RA-2860H | Recombinant Human IL10RA protein(31-230 aa), N-SUMO & C-His-tagged | +Inquiry |
Il10ra-1726M | Recombinant Mouse Il10ra protein, His & GST-tagged | +Inquiry |
IL10RA-4296H | Recombinant Human IL10RA Protein (His22-Asn235), C-Fc tagged | +Inquiry |
IL10RA-002H | Active Recombinant Human IL10RA Protein | +Inquiry |
IL10RA-1307C | Active Recombinant Cynomolgus IL10RA protein, Fc-tagged | +Inquiry |
◆ Native Proteins | ||
IL10RA-72H | Active Recombinant Human IL10RA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL10RA-1185CCL | Recombinant Cynomolgus IL10RA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL10RA Products
Required fields are marked with *
My Review for All IL10RA Products
Required fields are marked with *
0
Inquiry Basket