Recombinant Human IQCK Protein, GST-tagged
| Cat.No. : | IQCK-5062H |
| Product Overview : | Human IQCK full-length ORF ( NP_694940.1, 1 a.a. - 287 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene belongs to the IQ motif-containing family of proteins. The IQ motif serves as a binding site for different EF-hand proteins such as calmodulin. This gene was identified as a potential candidate gene for obsessive-compulsive disorder in a genome-wide association study. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Feb 2015] |
| Molecular Mass : | 59.7 kDa |
| AA Sequence : | MAAPRQIPSHIVRLKPSCSTDSSFTRTPVPTVSLASRELPVSSWQVTEPSSKNLWEQICKEYEAEQPPFPEGYKVKQEPVITVAPVEEMLFHGFSAEHYFPVSHFTMISRTPCPQDKSETINPKTCSPKEYLETFIFPVLLPGMASLLHQAKKEKCFERKRTKFIACDFLTEWLYNQNPKRAGEPFTEFFSIPFVEERLKQHPRPPIPLSLLLTEEEAALYIQSFWRACVVRCDPEIQELRQWQKKLREAKHIHQQVKIFWAKQEQKVKCKMEDDAVPAAKMKIPSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | IQCK IQ motif containing K [ Homo sapiens ] |
| Official Symbol | IQCK |
| Synonyms | IQCK; IQ motif containing K; IQ domain-containing protein K; FLJ36575; MGC35048; FLJ20115; |
| Gene ID | 124152 |
| mRNA Refseq | NM_153208 |
| Protein Refseq | NP_694940 |
| UniProt ID | Q8N0W5 |
| ◆ Recombinant Proteins | ||
| IQCK-6743H | Recombinant Human IQCK protein, GST-tagged | +Inquiry |
| IQCK-7036Z | Recombinant Zebrafish IQCK | +Inquiry |
| IQCK-5716HF | Recombinant Full Length Human IQCK Protein, GST-tagged | +Inquiry |
| IQCK-6744H | Recombinant Human IQCK protein, His-tagged | +Inquiry |
| IQCK-2288R | Recombinant Rhesus monkey IQCK Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IQCK-5176HCL | Recombinant Human IQCK 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IQCK Products
Required fields are marked with *
My Review for All IQCK Products
Required fields are marked with *
