Recombinant Human IRAK1BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : IRAK1BP1-2589H
Product Overview : IRAK1BP1 MS Standard C13 and N15-labeled recombinant protein (NP_001010844) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity.
Molecular Mass : 29.1 kDa
AA Sequence : MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens (human) ]
Official Symbol IRAK1BP1
Synonyms IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; 4921528N06Rik; ActA binding protein 3; MGC138458; MGC138460;
Gene ID 134728
mRNA Refseq NM_001010844
Protein Refseq NP_001010844
MIM 615375
UniProt ID Q5VVH5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRAK1BP1 Products

Required fields are marked with *

My Review for All IRAK1BP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon