Recombinant Human IRAK1BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: IRAK1BP1-2589H
• Product Overview: IRAK1BP1 MS Standard C13 and N15-labeled recombinant protein (NP_001010844) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity.
• Molecular Mass: 29.1 kDa
• AA Sequence: MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens (human) ]
• Official Symbol: IRAK1BP1
• Synonyms: IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; 4921528N06Rik; ActA binding protein 3; MGC138458; MGC138460
• Gene ID: 134728
• mRNA Refseq: NM_001010844
• Protein Refseq: NP_001010844
• MIM: 615375
• UniProt ID: Q5VVH5