Recombinant Human IRAK1BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | IRAK1BP1-2589H |
Product Overview : | IRAK1BP1 MS Standard C13 and N15-labeled recombinant protein (NP_001010844) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Component of the IRAK1-dependent TNFRSF1A signaling pathway that leads to NF-kappa-B activation and is required for cell survival. Acts by enhancing RELA transcriptional activity. |
Molecular Mass : | 29.1 kDa |
AA Sequence : | MSLQKTPPTRVFVELVPWADRSRENNLASGRETLPGLRHPLSSTQAQTATREVQVSGTSEVSAGPDRAQVVVRVSSTKEAAAEAKKSVCRRLDYITQSLQQQGVQAENITVTKDFRRVENAYHMEAEVCITFTEFGKMQNICNFLVEKLDSSVVISPPQFYHTPGSVENLRRQACLVAVENAWRKAQEVCNLVGQTLGKPLLIKEEETKEWEGQIDDHQSSRLSSSLTVQQKIKSATIHAASKVFITFEVKGKEKRKKHLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | IRAK1BP1 interleukin-1 receptor-associated kinase 1 binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | IRAK1BP1 |
Synonyms | IRAK1BP1; interleukin-1 receptor-associated kinase 1 binding protein 1; interleukin-1 receptor-associated kinase 1-binding protein 1; AIP70; SIMPL; 4921528N06Rik; ActA binding protein 3; MGC138458; MGC138460; |
Gene ID | 134728 |
mRNA Refseq | NM_001010844 |
Protein Refseq | NP_001010844 |
MIM | 615375 |
UniProt ID | Q5VVH5 |
◆ Recombinant Proteins | ||
Irak1bp1-3568M | Recombinant Mouse Irak1bp1 Protein, Myc/DDK-tagged | +Inquiry |
IRAK1BP1-2589H | Recombinant Human IRAK1BP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRAK1BP1-27501TH | Recombinant Human IRAK1BP1, His-tagged | +Inquiry |
IRAK1BP1-2111R | Recombinant Rhesus Macaque IRAK1BP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRAK1BP1-2290R | Recombinant Rhesus monkey IRAK1BP1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK1BP1-5172HCL | Recombinant Human IRAK1BP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK1BP1 Products
Required fields are marked with *
My Review for All IRAK1BP1 Products
Required fields are marked with *