Recombinant Human IRAK2 protein, His-tagged
Cat.No. : | IRAK2-270H |
Product Overview : | Recombinant Human SHANK2 protein(381-490 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 381-490 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | VDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP |
Gene Name | SHANK2 SH3 and multiple ankyrin repeat domains 2 [ Homo sapiens ] |
Official Symbol | SHANK2 |
Synonyms | SHANK; AUTS17; CORTBP1; CTTNBP1; ProSAP1; SPANK-3 |
Gene ID | 22941 |
mRNA Refseq | NM_133266.3 |
Protein Refseq | NP_573573.2 |
MIM | 603290 |
UniProt ID | Q9UPX8 |
◆ Recombinant Proteins | ||
IRAK2-270H | Recombinant Human IRAK2 protein, His-tagged | +Inquiry |
IRAK2-5729HF | Recombinant Full Length Human IRAK2 Protein, GST-tagged | +Inquiry |
IRAK2-2750R | Recombinant Rat IRAK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRAK2-332H | Recombinant Human IRAK2, GST-tagged, Active | +Inquiry |
IRAK2-8293M | Recombinant Mouse IRAK2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK2-5171HCL | Recombinant Human IRAK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK2 Products
Required fields are marked with *
My Review for All IRAK2 Products
Required fields are marked with *
0
Inquiry Basket