Recombinant Human IRAK2 protein, His-tagged
| Cat.No. : | IRAK2-270H |
| Product Overview : | Recombinant Human SHANK2 protein(381-490 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 381-490 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | VDKASVRKKKDKPEEIVPASKPSRAAENMAVEPRVATIKQRPSSRCFPAGSDMNSVYERQGIAVMTPTVPGSPKAPFLGIPRGTMRRQKSIDSRIFLSGITEEERQFLAP |
| Gene Name | SHANK2 SH3 and multiple ankyrin repeat domains 2 [ Homo sapiens ] |
| Official Symbol | SHANK2 |
| Synonyms | SHANK; AUTS17; CORTBP1; CTTNBP1; ProSAP1; SPANK-3 |
| Gene ID | 22941 |
| mRNA Refseq | NM_133266.3 |
| Protein Refseq | NP_573573.2 |
| MIM | 603290 |
| UniProt ID | Q9UPX8 |
| ◆ Recombinant Proteins | ||
| IRAK2-7653H | Recombinant Human IRAK2 protein, His-tagged | +Inquiry |
| IRAK2-3094R | Recombinant Rat IRAK2 Protein | +Inquiry |
| IRAK2-5729HF | Recombinant Full Length Human IRAK2 Protein, GST-tagged | +Inquiry |
| Irak2-7070M | Recombinant Mouse Irak2 protein, His-tagged | +Inquiry |
| IRAK2-1417H | Active Recombinant Human IRAK2, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRAK2-5171HCL | Recombinant Human IRAK2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRAK2 Products
Required fields are marked with *
My Review for All IRAK2 Products
Required fields are marked with *


