Recombinant Human IRAK4 Protein, His tagged

Cat.No. : IRAK4-35H
Product Overview : Recombinant Human IRAK4 Protein with His tag was expressed in E. coli.
Availability August 13, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 125-460 aa
Description : This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : The protein has a calculated MW of 39 kDa.
AA Sequence : MPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTASLEHHHHHH
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Concentration : 0.17 mg/mL
Storage Buffer : Sterile 50 mM Tris, 250 mM NaCl, pH7.8
Gene Name IRAK4 interleukin-1 receptor-associated kinase 4 [ Homo sapiens ]
Official Symbol IRAK4
Synonyms IRAK4; interleukin-1 receptor-associated kinase 4; NY REN 64; renal carcinoma antigen NY-REN-64; IPD1; REN64; IRAK-4; NY-REN-64;
Gene ID 51135
mRNA Refseq NM_001114182
Protein Refseq NP_001107654
MIM 606883
UniProt ID Q9NWZ3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRAK4 Products

Required fields are marked with *

My Review for All IRAK4 Products

Required fields are marked with *

0
cart-icon