Recombinant Human IRAK4 Protein, His tagged
Cat.No. : | IRAK4-35H |
Product Overview : | Recombinant Human IRAK4 Protein with His tag was expressed in E. coli. |
Availability | May 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 125-460 aa |
Description : | This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | The protein has a calculated MW of 39 kDa. |
AA Sequence : | MPFCDKDRTLMTPVQNLEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTVAVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGTPPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVGTTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMNDADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTASLEHHHHHH |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.17 mg/mL |
Storage Buffer : | Sterile 50 mM Tris, 250 mM NaCl, pH7.8 |
Gene Name | IRAK4 interleukin-1 receptor-associated kinase 4 [ Homo sapiens ] |
Official Symbol | IRAK4 |
Synonyms | IRAK4; interleukin-1 receptor-associated kinase 4; NY REN 64; renal carcinoma antigen NY-REN-64; IPD1; REN64; IRAK-4; NY-REN-64; |
Gene ID | 51135 |
mRNA Refseq | NM_001114182 |
Protein Refseq | NP_001107654 |
MIM | 606883 |
UniProt ID | Q9NWZ3 |
◆ Recombinant Proteins | ||
IRAK4-7074H | Recombinant Human IRAK4 protein, His-tagged | +Inquiry |
IRAK4-1168H | Recombinant Human IRAK4 Protein (E154-S460), Tag Free | +Inquiry |
IRAK4-2291R | Recombinant Rhesus monkey IRAK4 Protein, His-tagged | +Inquiry |
Irak4-0058M | Recombinant Mouse Irak4 protein(Ser169-Ala459), His-tagged | +Inquiry |
IRAK4-46H | Active Recombinant Human IRAK4 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK4-615HCL | Recombinant Human IRAK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRAK4 Products
Required fields are marked with *
My Review for All IRAK4 Products
Required fields are marked with *
0
Inquiry Basket