Recombinant Full Length Human IRAK4 Protein, C-Flag-tagged
Cat.No. : | IRAK4-940HFL |
Product Overview : | Recombinant Full Length Human IRAK4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a kinase that activates NF-kappaB in both the Toll-like receptor (TLR) and T-cell receptor (TCR) signaling pathways. The protein is essential for most innate immune responses. Mutations in this gene result in IRAK4 deficiency and recurrent invasive pneumococcal disease. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.3 kDa |
AA Sequence : | MNKPITPSTYVRCLNVGLIRKLSDFIDPQEGWKKLAVAIKKPSGDDRYNQFHIRRFEALLQTGKSPTSEL LFDWGTTNCTVGDLVDLLIQNEFFAPASLLLPDAVPKTANTLPSKEAITVQQKQMPFCDKDRTLMTPVQN LEQSYMPPDSSSPENKSLEVSDTRFHSFSFYELKNVTNNFDERPISVGGNKMGEGGFGVVYKGYVNNTTV AVKKLAAMVDITTEELKQQFDQEIKVMAKCQHENLVELLGFSSDGDDLCLVYVYMPNGSLLDRLSCLDGT PPLSWHMRCKIAQGAANGINFLHENHHIHRDIKSANILLDEAFTAKISDFGLARASEKFAQTVMTSRIVG TTAYMAPEALRGEITPKSDIYSFGVVLLEIITGLPAVDEHREPQLLLDIKEEIEDEEKTIEDYIDKKMND ADSTSVEAMYSVASQCLHEKKNKRPDIKKVQQLLQEMTASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Protein Kinase |
Protein Pathways : | Apoptosis, Neurotrophin signaling pathway, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | IRAK4 interleukin 1 receptor associated kinase 4 [ Homo sapiens (human) ] |
Official Symbol | IRAK4 |
Synonyms | IPD1; IMD67; REN64; IRAK-4; NY-REN-64 |
Gene ID | 51135 |
mRNA Refseq | NM_016123.4 |
Protein Refseq | NP_057207.2 |
MIM | 606883 |
UniProt ID | Q9NWZ3 |
◆ Recombinant Proteins | ||
IRAK4-27000TH | Recombinant Human IRAK4 | +Inquiry |
IRAK4-9963HF | Active Recombinant Full Length Human IRAK4 Protein, DDK-tagged, Biotinylated | +Inquiry |
IRAK4-7074H | Recombinant Human IRAK4 protein, His-tagged | +Inquiry |
IRAK4-2439C | Recombinant Chicken IRAK4 | +Inquiry |
IRAK4-1169H | Recombinant Human IRAK4 Protein (E154-S460), His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRAK4-615HCL | Recombinant Human IRAK4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRAK4 Products
Required fields are marked with *
My Review for All IRAK4 Products
Required fields are marked with *
0
Inquiry Basket