Recombinant Human IRF1 protein, His-HA-tagged
Cat.No. : | IRF1-3114H |
Product Overview : | Recombinant Human IRF1 protein(P10914)(1-325aa), fused to N-terminal His tag and HA tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | HA&His |
Protein Length : | 1-325aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.6 kDa |
AA Sequence : | MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IRF1 interferon regulatory factor 1 [ Homo sapiens ] |
Official Symbol | IRF1 |
Synonyms | IRF1; interferon regulatory factor 1; MAR; IRF-1; |
Gene ID | 3659 |
mRNA Refseq | NM_002198 |
Protein Refseq | NP_002189 |
MIM | 147575 |
UniProt ID | P10914 |
◆ Recombinant Proteins | ||
IRF1-1133H | Recombinant Human IRF1 protein, His&Myc-tagged | +Inquiry |
IRF1-5852H | Recombinant Human IRF1 protein, His&Myc-tagged | +Inquiry |
IRF1-1487H | Recombinant Human IRF1 protein, His&Myc-tagged | +Inquiry |
IRF1-3169H | Recombinant Human IRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF1-2752R | Recombinant Rat IRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF1 Products
Required fields are marked with *
My Review for All IRF1 Products
Required fields are marked with *
0
Inquiry Basket