Recombinant Human IRF1 protein, His-HA-tagged
| Cat.No. : | IRF1-3114H |
| Product Overview : | Recombinant Human IRF1 protein(P10914)(1-325aa), fused to N-terminal His tag and HA tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | HA&His |
| Protein Length : | 1-325aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.6 kDa |
| AA Sequence : | MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | IRF1 interferon regulatory factor 1 [ Homo sapiens ] |
| Official Symbol | IRF1 |
| Synonyms | IRF1; interferon regulatory factor 1; MAR; IRF-1; |
| Gene ID | 3659 |
| mRNA Refseq | NM_002198 |
| Protein Refseq | NP_002189 |
| MIM | 147575 |
| UniProt ID | P10914 |
| ◆ Recombinant Proteins | ||
| IRF1-5046H | Recombinant Human IRF1 Protein, GST-tagged | +Inquiry |
| IRF1-1133H | Recombinant Human IRF1 protein, His&Myc-tagged | +Inquiry |
| Irf1-3572M | Recombinant Mouse Irf1 Protein, Myc/DDK-tagged | +Inquiry |
| IRF1-2293R | Recombinant Rhesus monkey IRF1 Protein, His-tagged | +Inquiry |
| IRF1-3096R | Recombinant Rat IRF1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF1 Products
Required fields are marked with *
My Review for All IRF1 Products
Required fields are marked with *
