Recombinant Human IRGM protein, GST-tagged
Cat.No. : | IRGM-3118H |
Product Overview : | Recombinant Human IRGM protein(A1A4Y4)(1-181aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-181aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | IRGM immunity-related GTPase family, M [ Homo sapiens ] |
Official Symbol | IRGM |
Synonyms | IRGM; immunity-related GTPase family, M; immunity related GTPase family, M1 , IRGM1; immunity-related GTPase family M protein; IFI1; LRG 47; LRG47; LRG-47-like protein; interferon-inducible protein 1; immunity-related GTPase family, M1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; IRGM1; LRG-47; MGC149263; MGC149264; |
Gene ID | 345611 |
mRNA Refseq | NM_001145805 |
Protein Refseq | NP_001139277 |
MIM | 608212 |
UniProt ID | A1A4Y4 |
◆ Recombinant Proteins | ||
IRGM-394H | Recombinant Human immunity-related GTPase family, M, His-tagged | +Inquiry |
IRGM-2754R | Recombinant Rat IRGM Protein, His (Fc)-Avi-tagged | +Inquiry |
IRGM-3098R | Recombinant Rat IRGM Protein | +Inquiry |
IRGM-3118H | Recombinant Human IRGM protein, GST-tagged | +Inquiry |
IRGM-5030H | Recombinant Human IRGM Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRGM Products
Required fields are marked with *
My Review for All IRGM Products
Required fields are marked with *