Recombinant Human IRGM protein, GST-tagged

Cat.No. : IRGM-3118H
Product Overview : Recombinant Human IRGM protein(A1A4Y4)(1-181aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-181aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 47.1 kDa
AA Sequence : MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name IRGM immunity-related GTPase family, M [ Homo sapiens ]
Official Symbol IRGM
Synonyms IRGM; immunity-related GTPase family, M; immunity related GTPase family, M1 , IRGM1; immunity-related GTPase family M protein; IFI1; LRG 47; LRG47; LRG-47-like protein; interferon-inducible protein 1; immunity-related GTPase family, M1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; IRGM1; LRG-47; MGC149263; MGC149264;
Gene ID 345611
mRNA Refseq NM_001145805
Protein Refseq NP_001139277
MIM 608212
UniProt ID A1A4Y4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IRGM Products

Required fields are marked with *

My Review for All IRGM Products

Required fields are marked with *

0
cart-icon