Recombinant Human ISCA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ISCA2-3880H
Product Overview : ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 16.4 kDa
AA Sequence : MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ISCA2 iron-sulfur cluster assembly 2 [ Homo sapiens (human) ]
Official Symbol ISCA2
Synonyms ISCA2; iron-sulfur cluster assembly 2 homolog (S. cerevisiae); HBLD1, HesB like domain containing 1; iron-sulfur cluster assembly 2 homolog, mitochondrial; ISA2; HesB like domain containing 1; HESB-like domain-containing protein 1; HBLD1; c14_5557;
Gene ID 122961
mRNA Refseq NM_194279
Protein Refseq NP_919255
MIM 615317
UniProt ID Q86U28

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ISCA2 Products

Required fields are marked with *

My Review for All ISCA2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon