Recombinant Human ISCA2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: ISCA2-3880H
• Product Overview: ISCA2 MS Standard C13 and N15-labeled recombinant protein (NP_919255) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: The protein encoded by this gene is an A-type iron-sulfur cluster (ISC) protein found in mitochondria. The encoded protein appears to be involved in the maturation of mitochondrial iron-sulfur proteins. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Mass: 16.4 kDa
• AA Sequence: MAAAWGSSLTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQICLTDSCVQRLLEITEGSEFLRLQVEGGGCSGFQYKFSLDTVINPDDRVFEQGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVLNNPQAQQGCSCGSSFSIKLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: ISCA2 iron-sulfur cluster assembly 2 [ Homo sapiens (human) ]
• Official Symbol: ISCA2
• Synonyms: ISCA2; iron-sulfur cluster assembly 2 homolog (S. cerevisiae); HBLD1, HesB like domain containing 1; iron-sulfur cluster assembly 2 homolog, mitochondrial; ISA2; HesB like domain containing 1; HESB-like domain-containing protein 1; HBLD1; c14_5557
• Gene ID: 122961
• mRNA Refseq: NM_194279
• Protein Refseq: NP_919255
• MIM: 615317
• UniProt ID: Q86U28