Recombinant Human ISCU protein, His&Myc-tagged
Cat.No. : | ISCU-2344H |
Product Overview : | Recombinant Human ISCU protein(Q9H1K1)(35-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His&Myc |
Protein Length : | 35-167aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.3 kDa |
AA Sequence : | YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ISCU iron-sulfur cluster scaffold homolog (E. coli) [ Homo sapiens ] |
Official Symbol | ISCU |
Synonyms | ISCU; iron-sulfur cluster scaffold homolog (E. coli); IscU iron sulfur cluster scaffold homolog (E. coli) , NifU like N terminal domain containing , NIFUN; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; hnifU; IscU; ISU2; nifU-like protein; NifU-like N-terminal domain containing; IscU iron-sulfur cluster scaffold homolog; nifU-like N-terminal domain-containing protein; HML; NIFU; NIFUN; 2310020H20Rik; MGC74517; |
Gene ID | 23479 |
mRNA Refseq | NM_014301 |
Protein Refseq | NP_055116 |
MIM | 611911 |
UniProt ID | Q9H1K1 |
◆ Recombinant Proteins | ||
ISCU-4918H | Recombinant Human ISCU protein, GST-tagged | +Inquiry |
Iscu-3583M | Recombinant Mouse Iscu Protein, Myc/DDK-tagged | +Inquiry |
ISCU-2305R | Recombinant Rhesus monkey ISCU Protein, His-tagged | +Inquiry |
ISCU-2344H | Recombinant Human ISCU protein, His&Myc-tagged | +Inquiry |
ISCU-3378H | Recombinant Human ISCU, 20-650 aa, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ISCU-5153HCL | Recombinant Human ISCU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ISCU Products
Required fields are marked with *
My Review for All ISCU Products
Required fields are marked with *
0
Inquiry Basket