Recombinant Human ISCU protein, His&Myc-tagged
| Cat.No. : | ISCU-2344H |
| Product Overview : | Recombinant Human ISCU protein(Q9H1K1)(35-167aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect Cells |
| Tag : | His&Myc |
| Protein Length : | 35-167aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 18.3 kDa |
| AA Sequence : | YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | ISCU iron-sulfur cluster scaffold homolog (E. coli) [ Homo sapiens ] |
| Official Symbol | ISCU |
| Synonyms | ISCU; iron-sulfur cluster scaffold homolog (E. coli); IscU iron sulfur cluster scaffold homolog (E. coli) , NifU like N terminal domain containing , NIFUN; iron-sulfur cluster assembly enzyme ISCU, mitochondrial; hnifU; IscU; ISU2; nifU-like protein; NifU-like N-terminal domain containing; IscU iron-sulfur cluster scaffold homolog; nifU-like N-terminal domain-containing protein; HML; NIFU; NIFUN; 2310020H20Rik; MGC74517; |
| Gene ID | 23479 |
| mRNA Refseq | NM_014301 |
| Protein Refseq | NP_055116 |
| MIM | 611911 |
| UniProt ID | Q9H1K1 |
| ◆ Recombinant Proteins | ||
| ISCU-4918H | Recombinant Human ISCU protein, GST-tagged | +Inquiry |
| ISCU-2775B | Recombinant Bacillus subtilis ISCU protein, His-tagged | +Inquiry |
| Iscu-3583M | Recombinant Mouse Iscu Protein, Myc/DDK-tagged | +Inquiry |
| ISCU-945H | Recombinant Human ISCU, 35-167 aa, His-tagged | +Inquiry |
| ISCU-4620M | Recombinant Mouse ISCU Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ISCU-5153HCL | Recombinant Human ISCU 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ISCU Products
Required fields are marked with *
My Review for All ISCU Products
Required fields are marked with *
