"ISL1" Related Products

Expand

Recombinant Human ISL1 protein, Arginine-tagged

Cat.No.: ISL1-149H
Product Overview: Recombinant human ISL1 protein fused with 11 arginine domain at C-terminal, which efficiently delivery protein intracellularly, was expressed in E. coli.
Source: E. coli
Species: Human
Tag: Arginine
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: GDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFVRDGKTYCKRDYIRLYG IKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEFALREDGLFCRADHDVVERASLGAGDPLSPLH PARPLQMAAEPISARQPALRPHVHKQPEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIR VWFQNKRCKDKKRSIMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQS DIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEALEESGGGGSPGRRRRRRRRRRR
Purity: >90% by SDS-PAGE
Applications: 1. Protein transduction for endocrine pancreas cell trans-differentiation.2. Active protein, may be used for ELISA based DNA/Protein binding assay.3. As specific protein substrate for kinase assay. 4. Immunogen for specific antibody production.
Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.
Gene Name: ISL1 ISL LIM homeobox 1 [ Homo sapiens ]
Official Symbol: ISL1
Synonyms: ISL1; ISL LIM homeobox 1; insulin gene enhancer protein ISL-1; Isl 1; ISLET1; islet-1; ISL1 transcription factor, LIM/homeodomain; Isl-1;
Gene ID: 3670
mRNA Refseq: NM_002202
Protein Refseq: NP_002193
MIM: 600366
UniProt ID: P61371
Chromosome Location: 5q11.2
Pathway: Heart Development, organism-specific biosystem; Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucose-dependent Insulinotropic Polypeptide (GIP), organism-specific biosystem;
Function: RNA polymerase II activating transcription factor binding; RNA polymerase II transcription coactivator activity; bHLH transcription factor binding; chromatin binding; enhancer sequence-specific DNA binding; enhancer sequence-specific DNA binding; estrogen receptor binding; ligand-dependent nuclear receptor binding; metal ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.