Recombinant Human ITGA2 Protein, GST-tagged
| Cat.No. : | ITGA2-5000H |
| Product Overview : | Human ITGA2 partial ORF (NP_002194.2, 30 a.a. - 119 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 30-119 a.a. |
| Description : | This gene product belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane glycoproteins composed of a distinct alpha chain and a common beta chain. They are found on a wide variety of cell types including, T cells, fibroblasts and platelets. Integrins are involved in cell adhesion and also participate in cell-surface mediated signalling. [provided by RefSeq |
| Molecular Mass : | 35.53 kDa |
| AA Sequence : | YNVGLPEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLIL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ITGA2 integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor) [ Homo sapiens ] |
| Official Symbol | ITGA2 |
| Synonyms | ITGA2; integrin, alpha 2 (CD49B, alpha 2 subunit of VLA-2 receptor); CD49B; integrin alpha-2; CD49b; integrin alpha 2; collagen receptor; VLA-2 subunit alpha; platelet antigen Br; platelet glycoprotein Ia; platelet glycoprotein GPIa; CD49 antigen-like family member B; platelet membrane glycoprotein Ia; very late activation protein 2 receptor, alpha-2 subunit; BR; GPIa; VLA-2; VLAA2; BDPLT9; |
| Gene ID | 3673 |
| mRNA Refseq | NM_002203 |
| Protein Refseq | NP_002194 |
| MIM | 192974 |
| UniProt ID | P17301 |
| ◆ Recombinant Proteins | ||
| ITGA2-4634M | Recombinant Mouse ITGA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGA2-5838M | Recombinant Monkey ITGA2 (Met1-Pro908) and ITGB3 (Met1-Pro717) Protein, C-His and C-Strep tagged | +Inquiry |
| ITGA2-5000H | Recombinant Human ITGA2 Protein, GST-tagged | +Inquiry |
| ITGA2-3123H | Recombinant Human ITGA2 protein, His-SUMO-tagged | +Inquiry |
| Itga2-5837M | Recombinant Mouse Itga2 protein, His & GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGA2-5135HCL | Recombinant Human ITGA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA2 Products
Required fields are marked with *
My Review for All ITGA2 Products
Required fields are marked with *
