Recombinant Human ITGA4 Protein, GST-tagged
Cat.No. : | ITGA4-4997H |
Product Overview : | Human ITGA4 partial ORF ( NP_000876, 98 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGA4 integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) [ Homo sapiens ] |
Official Symbol | ITGA4 |
Synonyms | ITGA4; integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor); CD49D; integrin alpha-4; CD49d; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 subunit; IA4; MGC90518; |
Gene ID | 3676 |
mRNA Refseq | NM_000885 |
Protein Refseq | NP_000876 |
MIM | 192975 |
UniProt ID | P13612 |
◆ Recombinant Proteins | ||
ITGA4-2340H | Recombinant Human ITGA4 Protein, His-tagged | +Inquiry |
ITGA4-664HFL | Recombinant Full Length Human ITGA4 Protein, C-Flag-tagged | +Inquiry |
ITGA4-4998H | Recombinant Human ITGA4 Protein | +Inquiry |
ITGA4-8350M | Recombinant Mouse ITGA4 Protein | +Inquiry |
Itga4-1696M | Recombinant Mouse Itga4 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGA4-5133HCL | Recombinant Human ITGA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGA4 Products
Required fields are marked with *
My Review for All ITGA4 Products
Required fields are marked with *
0
Inquiry Basket