Recombinant Human ITGA4 Protein, GST-tagged

Cat.No. : ITGA4-4997H
Product Overview : Human ITGA4 partial ORF ( NP_000876, 98 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The product of this gene belongs to the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an alpha 4 chain. Unlike other integrin alpha chains, alpha 4 neither contains an I-domain, nor undergoes disulfide-linked cleavage. Alpha 4 chain associates with either beta 1 chain or beta 7 chain. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : RIGKNPGQTCEQLQLGSPNGEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYVKKFGENFASCQAG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITGA4 integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor) [ Homo sapiens ]
Official Symbol ITGA4
Synonyms ITGA4; integrin, alpha 4 (antigen CD49D, alpha 4 subunit of VLA-4 receptor); CD49D; integrin alpha-4; CD49d; 269C wild type; integrin alpha 4; integrin alpha-IV; VLA-4 subunit alpha; integrin alpha-4 subunit; CD49 antigen-like family member D; antigen CD49D, alpha-4 subunit of VLA-4 receptor; very late activation protein 4 receptor, alpha 4 subunit; IA4; MGC90518;
Gene ID 3676
mRNA Refseq NM_000885
Protein Refseq NP_000876
MIM 192975
UniProt ID P13612

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGA4 Products

Required fields are marked with *

My Review for All ITGA4 Products

Required fields are marked with *

0
cart-icon
0
compare icon