| Species : |
Human |
| Source : |
E.coli |
| Tag : |
ABP&His |
| Description : |
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants. |
| Molecular Mass : |
32 kDa including tags |
| AA Sequence : |
APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS |
| Purity : |
>80% by SDS-PAGE and Coomassie blue staining |
| Applications : |
Blocking agent and positive assay control using corresponding antibodies. |
| Notes : |
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| Storage : |
Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles. |
| Concentration : |
≥0.5 mg/mL |
| Storage Buffer : |
PBS and 1M Urea, pH 7.4. |
| Shipping : |
Shipped in liquid form on wet ice. |
