Recombinant Human ITGA6 Protein, N-His6ABP tagged

Cat.No. : ITGA6-06H
Product Overview : Recombinant Human ITGA6 Protein with N-His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G) tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : ABP&His
Description : The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.
Molecular Mass : 32 kDa including tags
AA Sequence : APYDDLGKVFIYHGSANGINTKPTQVLKGISPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTITVTPNRIDLRQKTACGAPSGICLQVKSCFEYTANPAGYNPSISIVGTLEAEKERRKSGLSS
Purity : >80% by SDS-PAGE and Coomassie blue staining
Applications : Blocking agent and positive assay control using corresponding antibodies.
Notes : Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Storage : Upon delivery store at -20 centigrade. Avoid repeated freeze/thaw cycles.
Concentration : ≥0.5 mg/mL
Storage Buffer : PBS and 1M Urea, pH 7.4.
Shipping : Shipped in liquid form on wet ice.
Gene Name ITGA6 integrin, alpha 6 [ Homo sapiens (human) ]
Official Symbol ITGA6
Synonyms ITGA6; integrin, alpha 6; integrin alpha-6; CD49f; integrin alpha6B; CD49 antigen-like family member F; VLA-6; ITGA6B; FLJ18737; DKFZp686J01244;
Gene ID 3655
mRNA Refseq NM_000210
Protein Refseq NP_000201
MIM 147556
UniProt ID P23229

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGA6 Products

Required fields are marked with *

My Review for All ITGA6 Products

Required fields are marked with *

0
cart-icon