Recombinant Human ITGA7 Protein, GST-tagged

Cat.No. : ITGA7-4994H
Product Overview : Human ITGA7 partial ORF ( NP_002197, 478 a.a. - 577 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene belongs to the integrin alpha chain family. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. They mediate a wide spectrum of cell-cell and cell-matrix interactions, and thus play a role in cell migration, morphologic development, differentiation, and metastasis. This protein functions as a receptor for the basement membrane protein laminin-1. It is mainly expressed in skeletal and cardiac muscles and may be involved in differentiation and migration processes during myogenesis. Defects in this gene are associated with congenital myopathy. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq
Molecular Mass : 36.74 kDa
AA Sequence : SHEVSIAPRSIDLEQPNCAGGHSVCVDLRVCFSYIAVPSSYSPTVALDYVLDADTDRRLRGQVPRVTFLSRNLEEPKHQASGTVWLKHQHDRVCGDAMFQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITGA7 integrin, alpha 7 [ Homo sapiens ]
Official Symbol ITGA7
Synonyms ITGA7; integrin, alpha 7; integrin alpha-7; integrin alpha 7 chain; FLJ25220;
Gene ID 3679
mRNA Refseq NM_001144996
Protein Refseq NP_001138468
MIM 600536
UniProt ID Q13683

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGA7 Products

Required fields are marked with *

My Review for All ITGA7 Products

Required fields are marked with *

0
cart-icon
0
compare icon