Recombinant Human ITGA9 Protein, GST-tagged

• Cat.No.: ITGA9-4992H
• Product Overview: Human ITGA9 partial ORF ( NP_002198, 785 a.a. - 886 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an alpha integrin. Integrins are heterodimeric integral membrane glycoproteins composed of an alpha chain and a beta chain that mediate cell-cell and cell-matrix adhesion. The protein encoded by this gene, when bound to the beta 1 chain, forms an integrin that is a receptor for VCAM1, cytotactin and osteopontin. Expression of this gene has been found to be upregulated in small cell lung cancers. [provided by RefSeq
• Molecular Mass: 36.96 kDa
• AA Sequence: GESVDAANFIQLDDLECHFQPINITLQVYNTGPSTLPGSSVSISFPNRLSSGGAEMFHVQEMVVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFFTKSGR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ITGA9 integrin, alpha 9 [ Homo sapiens ]
• Official Symbol: ITGA9
• Synonyms: ITGA9; integrin, alpha 9; integrin alpha-9; ALPHA RLC; integrin; alpha 4 like; ITGA4L; RLC; integrin alpha-RLC; ALPHA-RLC
• Gene ID: 3680
• mRNA Refseq: NM_002207
• Protein Refseq: NP_002198
• MIM: 603963
• UniProt ID: Q13797