Recombinant Human ITGAD Protein, GST-tagged

Cat.No. : ITGAD-4991H
Product Overview : Human ITGAD partial ORF ( NP_061194, 112 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the beta-2 integrin family of membrane glycoproteins, which are are composed of non-covalently linked alpha and beta subunits to form a heterodimer. It encodes the alpha subunit of the cell surface heterodimers and is involved in the activation and adhesion functions of leukocytes. The gene is located about 11kb downstream of the integrin subunit alpha X gene, another member of the integrin family. It is expressed in the tissue and circulating myeloid leukocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Molecular Mass : 36.96 kDa
AA Sequence : RVCGENSYSKGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQFEGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITGAD integrin subunit alpha D [ Homo sapiens (human) ]
Official Symbol ITGAD
Synonyms ITGAD; integrin subunit alpha D; ADB2; CD11D; integrin alpha-D; CD11 antigen-like family member D; beta-2 integrin alphaD subunit; leukointegrin alpha D
Gene ID 3681
mRNA Refseq NM_001318185
Protein Refseq NP_001305114
MIM 602453
UniProt ID Q13349

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAD Products

Required fields are marked with *

My Review for All ITGAD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon