Recombinant Human ITGAD Protein, GST-tagged
Cat.No. : | ITGAD-4991H |
Product Overview : | Human ITGAD partial ORF ( NP_061194, 112 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene belongs to the beta-2 integrin family of membrane glycoproteins, which are are composed of non-covalently linked alpha and beta subunits to form a heterodimer. It encodes the alpha subunit of the cell surface heterodimers and is involved in the activation and adhesion functions of leukocytes. The gene is located about 11kb downstream of the integrin subunit alpha X gene, another member of the integrin family. It is expressed in the tissue and circulating myeloid leukocytes. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015] |
Molecular Mass : | 36.96 kDa |
AA Sequence : | RVCGENSYSKGSCLLLGSRWEIIQTVPDATPECPHQEMDIVFLIDGSGSIDQNDFNQMKGFVQAVMGQFEGTDTLFALMQYSNLLKIHFTFTQFRTSPSQQS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGAD integrin subunit alpha D [ Homo sapiens (human) ] |
Official Symbol | ITGAD |
Synonyms | ITGAD; integrin subunit alpha D; ADB2; CD11D; integrin alpha-D; CD11 antigen-like family member D; beta-2 integrin alphaD subunit; leukointegrin alpha D |
Gene ID | 3681 |
mRNA Refseq | NM_001318185 |
Protein Refseq | NP_001305114 |
MIM | 602453 |
UniProt ID | Q13349 |
◆ Recombinant Proteins | ||
Itgad-3599M | Recombinant Mouse Itgad Protein, Myc/DDK-tagged | +Inquiry |
ITGAD-1213H | Recombinant Human ITGAD Protein, His (Fc)-Avi-tagged | +Inquiry |
Itgad-340R | Recombinant Rat Itgad Protein, His-tagged | +Inquiry |
ITGAD-4991H | Recombinant Human ITGAD Protein, GST-tagged | +Inquiry |
ITGAD-1941HFL | Recombinant Full Length Human ITGAD Protein, C-Flag-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGAD Products
Required fields are marked with *
My Review for All ITGAD Products
Required fields are marked with *
0
Inquiry Basket