Recombinant Human ITGAM protein(131-350 aa), N-SUMO & C-His-tagged

Cat.No. : ITGAM-2635H
Product Overview : Recombinant Human ITGAM protein(P11215)(131-350 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 131-350 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : RQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM
Gene Name ITGAM integrin, alpha M (complement component 3 receptor 3 subunit) [ Homo sapiens ]
Official Symbol ITGAM
Synonyms ITGAM; integrin, alpha M (complement component 3 receptor 3 subunit); CD11B, CR3A, integrin, alpha M (complement component receptor 3, alpha; also known as CD11b (p170), macrophage antigen alpha polypeptide); integrin alpha-M; CD11b; MAC 1; CR-3 alpha chain; antigen CD11b (p170); leukocyte adhesion receptor MO1; CD11 antigen-like family member B; macrophage antigen alpha polypeptide; cell surface glycoprotein MAC-1 subunit alpha; neutrophil adherence receptor alpha-M subunit; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; MGC117044;
Gene ID 3684
mRNA Refseq NM_000632
Protein Refseq NP_000623
MIM 120980
UniProt ID P11215

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAM Products

Required fields are marked with *

My Review for All ITGAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon