Recombinant Human ITGAM protein(131-350 aa), N-SUMO & C-His-tagged
Cat.No. : | ITGAM-2635H |
Product Overview : | Recombinant Human ITGAM protein(P11215)(131-350 aa), fused with N-terminal SUMO tag and C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 131-350 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | RQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKTLFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQLLGRTHTATGIRKVVRELFNITNGARKNAFKILVVITDGEKFGDPLGYEDVIPEADREGVIRYVIGVGDAFRSEKSRQELNTIASKPPRDHVFQVNNFEALKTIQNQLREKIFAIEGTQTGSSSSFEHEM |
Gene Name | ITGAM integrin, alpha M (complement component 3 receptor 3 subunit) [ Homo sapiens ] |
Official Symbol | ITGAM |
Synonyms | ITGAM; integrin, alpha M (complement component 3 receptor 3 subunit); CD11B, CR3A, integrin, alpha M (complement component receptor 3, alpha; also known as CD11b (p170), macrophage antigen alpha polypeptide); integrin alpha-M; CD11b; MAC 1; CR-3 alpha chain; antigen CD11b (p170); leukocyte adhesion receptor MO1; CD11 antigen-like family member B; macrophage antigen alpha polypeptide; cell surface glycoprotein MAC-1 subunit alpha; neutrophil adherence receptor alpha-M subunit; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; MGC117044; |
Gene ID | 3684 |
mRNA Refseq | NM_000632 |
Protein Refseq | NP_000623 |
MIM | 120980 |
UniProt ID | P11215 |
◆ Recombinant Proteins | ||
ITGAM-1215H | Recombinant Human ITGAM Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGAM-231H | Recombinant Human ITGAM, GST-tagged | +Inquiry |
ITGAM-4257H | Recombinant Human Integrin, Alpha M (Complement Component 3 Receptor 3 Subunit) | +Inquiry |
ITGAM-1064H | Recombinant Human ITGAM Protein, His&GST-tagged | +Inquiry |
ITGAM-264HF | Recombinant Full Length Human ITGAM Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGAM Products
Required fields are marked with *
My Review for All ITGAM Products
Required fields are marked with *
0
Inquiry Basket