Recombinant Human ITGAV protein, GST-tagged
Cat.No. : | ITGAV-301294H |
Product Overview : | Recombinant Human ITGAV (819-915 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser819-Gln915 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | ITGAV integrin, alpha V [ Homo sapiens ] |
Official Symbol | ITGAV |
Synonyms | ITGAV; integrin, alpha V; antigen identified by monoclonal L230 , integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) , MSK8, vitronectin receptor , VNRA, VTNR; integrin alpha-V; CD51; integrin alphaVbeta3; vitronectin receptor subunit alpha; antigen identified by monoclonal L230; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); MSK8; VNRA; VTNR; DKFZp686A08142; |
Gene ID | 3685 |
mRNA Refseq | NM_001144999 |
Protein Refseq | NP_001138471 |
MIM | 193210 |
UniProt ID | P06756 |
◆ Recombinant Proteins | ||
ITGAV-2775H | Recombinant Human ITGAV protein, His-tagged | +Inquiry |
ITGAV-301294H | Recombinant Human ITGAV protein, GST-tagged | +Inquiry |
ITGAV-265HF | Recombinant Full Length Human ITGAV Protein | +Inquiry |
ITGAVB3-103H | Active Recombinant Human ITGAVB3 | +Inquiry |
ITGAV-0032B | Recombinant Bovine ITGAV Protein (Ala30-Pro993), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGAV-877HCL | Recombinant Human ITGAV cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAV Products
Required fields are marked with *
My Review for All ITGAV Products
Required fields are marked with *