Recombinant Human ITGAV protein, His-tagged

Cat.No. : ITGAV-2775H
Product Overview : Recombinant Human ITGAV protein(819-915 aa), fused to His tag, was expressed in E. coli.
Availability January 07, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 819-915 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : SFSKAMLHLQWPYKYNNNTLLYILHYDIDGPMNCTSDMEINPLRIKISSLQTTEKNDTVAGQGERDHLITKRDLALSEGDIHTLGCGVAQCLKIVCQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name ITGAV integrin, alpha V [ Homo sapiens ]
Official Symbol ITGAV
Synonyms ITGAV; integrin, alpha V; antigen identified by monoclonal L230 , integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) , MSK8, vitronectin receptor , VNRA, VTNR; integrin alpha-V; CD51; integrin alphaVbeta3; vitronectin receptor subunit alpha; antigen identified by monoclonal L230; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); MSK8; VNRA; VTNR; DKFZp686A08142;
Gene ID 3685
mRNA Refseq NM_001144999
Protein Refseq NP_001138471
MIM 193210
UniProt ID P06756

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAV Products

Required fields are marked with *

My Review for All ITGAV Products

Required fields are marked with *

0
cart-icon
0
compare icon