Recombinant Human ITGAX Protein, GST-tagged
Cat.No. : | ITGAX-4987H |
Product Overview : | Human ITGAX partial ORF ( NP_000878, 114 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the integrin alpha X chain protein. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This protein combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as inactivated-C3b (iC3b) receptor 4 (CR4). The alpha X beta 2 complex seems to overlap the properties of the alpha M beta 2 integrin in the adherence of neutrophils and monocytes to stimulated endothelium cells, and in the phagocytosis of complement coated particles. [provided by RefSeq |
Molecular Mass : | 37.84 kDa |
AA Sequence : | HECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQFQRPSTQFSLMQFSNKFQTHFTFEEFRRSSNPLSLLASVHQLQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGAX integrin, alpha X (complement component 3 receptor 4 subunit) [ Homo sapiens ] |
Official Symbol | ITGAX |
Synonyms | ITGAX; integrin, alpha X (complement component 3 receptor 4 subunit); CD11C, integrin, alpha X (antigen CD11C (p150), alpha polypeptide); integrin alpha-X; CD11c; leu M5, alpha subunit; p150 95 integrin alpha chain; CD11 antigen-like family member C; leukocyte adhesion receptor p150,95; myeloid membrane antigen, alpha subunit; leukocyte surface antigen p150,95, alpha subunit; leukocyte adhesion glycoprotein p150,95 alpha chain; integrin, alpha X (antigen CD11C (p150), alpha polypeptide); CD11C; SLEB6; |
Gene ID | 3687 |
mRNA Refseq | NM_000887 |
Protein Refseq | NP_000878 |
MIM | 151510 |
UniProt ID | P20702 |
◆ Recombinant Proteins | ||
ITGAX-1066H | Recombinant Human ITGAX Protein, His-tagged | +Inquiry |
ITGAX-3177H | Recombinant Human ITGAX Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGAX-4987H | Recombinant Human ITGAX Protein, GST-tagged | +Inquiry |
ITGAX-1553H | Recombinant Human ITGAX protein, His-tagged | +Inquiry |
ITGAX-266H | Recombinant Human ITGAX | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGAX Products
Required fields are marked with *
My Review for All ITGAX Products
Required fields are marked with *