Recombinant Human ITGB3 protein(621-700 aa), C-His-tagged
Cat.No. : | ITGB3-2554H |
Product Overview : | Recombinant Human ITGB3 protein(P05106)(621-700 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 621-700 aa |
Form : | 0.15 M Phosphate buffered saline |
Molecular Mass : | 11.5 kDa |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | GDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS |
Gene Name | ITGB3 integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) [ Homo sapiens ] |
Official Symbol | ITGB3 |
Synonyms | ITGB3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); GP3A; integrin beta-3; CD61; GPIIIa; platelet glycoprotein IIIa; platelet membrane glycoprotein IIIa; GT; BDPLT2; |
Gene ID | 3690 |
mRNA Refseq | NM_000212 |
Protein Refseq | NP_000203 |
UniProt ID | P05106 |
◆ Recombinant Proteins | ||
ITGB3-2940H | Recombinant Human ITGB3 protein, His-tagged | +Inquiry |
Itgb3-3606M | Recombinant Mouse Itgb3 Protein, Myc/DDK-tagged | +Inquiry |
ITGB3-8366M | Recombinant Mouse ITGB3 Protein | +Inquiry |
RFL9745MF | Recombinant Full Length Mouse Integrin Beta-3(Itgb3) Protein, His-Tagged | +Inquiry |
ITGB3-12H | Recombinant Human ITGB3 protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB3-5124HCL | Recombinant Human ITGB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGB3 Products
Required fields are marked with *
My Review for All ITGB3 Products
Required fields are marked with *
0
Inquiry Basket