Recombinant Human ITGB3 protein(621-700 aa), C-His-tagged
| Cat.No. : | ITGB3-2554H |
| Product Overview : | Recombinant Human ITGB3 protein(P05106)(621-700 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 621-700 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Molecular Mass : | 11.5 kDa |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | GDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSS |
| Gene Name | ITGB3 integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61) [ Homo sapiens ] |
| Official Symbol | ITGB3 |
| Synonyms | ITGB3; integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61); GP3A; integrin beta-3; CD61; GPIIIa; platelet glycoprotein IIIa; platelet membrane glycoprotein IIIa; GT; BDPLT2; |
| Gene ID | 3690 |
| mRNA Refseq | NM_000212 |
| Protein Refseq | NP_000203 |
| UniProt ID | P05106 |
| ◆ Recombinant Proteins | ||
| ITGB3-16H | Recombinant Human ITGB3 Protein, His-tagged | +Inquiry |
| ITGb3-3269H | Recombinant Human ITGb3 protein, His-tagged | +Inquiry |
| ITGB3-4645M | Recombinant Mouse ITGB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ITGB3-151H | Recombinant Human ITGB3 Protein, DYKDDDDK-tagged | +Inquiry |
| ITGB3-12H | Recombinant Human ITGB3 protein, MYC/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB3-5124HCL | Recombinant Human ITGB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB3 Products
Required fields are marked with *
My Review for All ITGB3 Products
Required fields are marked with *
