Recombinant Human ITGB3BP protein, His-tagged
| Cat.No. : | ITGB3BP-2506H |
| Product Overview : | Recombinant Human ITGB3BP protein(1-177 aa), fused to His tag, was expressed in E. coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-177 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | ITGB3BP integrin beta 3 binding protein (beta3-endonexin) [ Homo sapiens ] |
| Official Symbol | ITGB3BP |
| Synonyms | ITGB3BP; integrin beta 3 binding protein (beta3-endonexin); centromere protein R; CENPR; HSU37139; NRIF3; TAP20; beta 3 endonexin; beta-3-endonexin; integrin beta-3-binding protein; nuclear receptor-interacting factor 3; CENP-R; |
| Gene ID | 23421 |
| mRNA Refseq | NM_001206739 |
| Protein Refseq | NP_001193668 |
| MIM | 605494 |
| UniProt ID | Q13352 |
| ◆ Recombinant Proteins | ||
| ITGB3BP-4975H | Recombinant Human ITGB3BP Protein, GST-tagged | +Inquiry |
| ITGB3BP-2506H | Recombinant Human ITGB3BP protein, His-tagged | +Inquiry |
| ITGB3BP-3126H | Recombinant Human ITGB3BP Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ITGB3BP-5781HF | Recombinant Full Length Human ITGB3BP Protein, GST-tagged | +Inquiry |
| ITGB3BP-543H | Recombinant Human integrin beta 3 binding protein (beta3-endonexin), His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITGB3BP-5123HCL | Recombinant Human ITGB3BP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB3BP Products
Required fields are marked with *
My Review for All ITGB3BP Products
Required fields are marked with *
