Recombinant Human ITGB6 protein, His-tagged
Cat.No. : | ITGB6-3196H |
Product Overview : | Recombinant Human ITGB6 protein(596-709 aa), fused to His tag, was expressed in E. coli. |
Availability | October 19, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 596-709 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | DCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEKDCPKPPNIP |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ITGB6 integrin, beta 6 [ Homo sapiens ] |
Official Symbol | ITGB6 |
Synonyms | ITGB6; integrin, beta 6; integrin beta-6; |
Gene ID | 3694 |
mRNA Refseq | NM_000888 |
Protein Refseq | NP_000879 |
MIM | 147558 |
UniProt ID | P18564 |
◆ Recombinant Proteins | ||
ITGB6-2773R | Recombinant Rat ITGB6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Itgb6-460M | Recombinant Mouse ITGB6 Protein | +Inquiry |
ITGB6-259HF | Recombinant Full Length Human ITGB6 Protein | +Inquiry |
ITGB6-3117R | Recombinant Rat ITGB6 Protein | +Inquiry |
ITGB6-6454H | Recombinant Human ITGB6 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGB6-5122HCL | Recombinant Human ITGB6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGB6 Products
Required fields are marked with *
My Review for All ITGB6 Products
Required fields are marked with *