Recombinant Human ITK protein, His-tagged
| Cat.No. : | ITK-3745H |
| Product Overview : | Recombinant Human ITK protein(151-258 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | December 07, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 151-258 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | NASKKPLPPTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYNKSISRDKAEKLLLDTGK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ITK IL2-inducible T-cell kinase [ Homo sapiens ] |
| Official Symbol | ITK |
| Synonyms | ITK; IL2-inducible T-cell kinase; tyrosine-protein kinase ITK/TSK; EMT; LYK; PSCTK2; kinase EMT; T-cell-specific kinase; tyrosine-protein kinase LYK; IL-2-inducible T cell kinase; IL-2-inducible T-cell kinase; homolog of mouse T-cell itk/tsk; interleukin-2-inducible T cell kinase; interleukin-2-inducible T-cell kinase; MGC126257; MGC126258; |
| Gene ID | 3702 |
| mRNA Refseq | NM_005546 |
| Protein Refseq | NP_005537 |
| MIM | 186973 |
| UniProt ID | Q08881 |
| ◆ Recombinant Proteins | ||
| ITK-2640H | Recombinant Human ITK Protein, MYC/DDK-tagged | +Inquiry |
| ITK-4960H | Recombinant Human ITK Protein, GST-tagged | +Inquiry |
| ITK-576H | Recombinant Human ITK protein(Arg352-Leu620), GST-tagged | +Inquiry |
| Itk-861M | Recombinant Mouse Itk Protein, GST & His-tagged | +Inquiry |
| ITK-2227H | Recombinant Human ITK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ITK-418MCL | Recombinant Mouse ITK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITK Products
Required fields are marked with *
My Review for All ITK Products
Required fields are marked with *
