Recombinant Human JAG2
| Cat.No. : | JAG2-29877TH | 
| Product Overview : | Recombinant fragment corresponding to amino acids 121-210 of Human Jagged 2 with a N terminal proprietary tag; predicted MWt 35.53 kDa inclusive of tag. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | Non | 
| Protein Length : | 90 amino acids | 
| Description : | The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene. | 
| Molecular Weight : | 35.530kDa inclusive of tags | 
| Form : | Liquid | 
| Purity : | Proprietary Purification | 
| Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl | 
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. | 
| Sequences of amino acids : | AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF | 
| Gene Name | JAG2 jagged 2 [ Homo sapiens ] | 
| Official Symbol | JAG2 | 
| Synonyms | JAG2; jagged 2; protein jagged-2; | 
| Gene ID | 3714 | 
| mRNA Refseq | NM_002226 | 
| Protein Refseq | NP_002217 | 
| MIM | 602570 | 
| Uniprot ID | Q9Y219 | 
| Chromosome Location | 14q32 | 
| Pathway | Delta-Notch Signaling Pathway, organism-specific biosystem; Notch receptor binds with a ligand, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem; | 
| Function | Notch binding; calcium ion binding; growth factor activity; protein binding; | 
| ◆ Recombinant Proteins | ||
| Jag2-79M | Recombinant Mouse Jag2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| JAG2-3182H | Recombinant Human JAG2 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| Jag2-383M | Recombinant Mouse Jag2, Fc-tagged | +Inquiry | 
| JAG2-29877TH | Recombinant Human JAG2 | +Inquiry | 
| Jag2-5666M | Active Recombinant Mouse Jagged 2, Fc-tagged | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAG2 Products
Required fields are marked with *
My Review for All JAG2 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            