Recombinant Human JAG2

Cat.No. : JAG2-29877TH
Product Overview : Recombinant fragment corresponding to amino acids 121-210 of Human Jagged 2 with a N terminal proprietary tag; predicted MWt 35.53 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 90 amino acids
Description : The Notch signaling pathway is an intercellular signaling mechanism that is essential for proper embryonic development. Members of the Notch gene family encode transmembrane receptors that are critical for various cell fate decisions. The protein encoded by this gene is one of several ligands that activate Notch and related receptors. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight : 35.530kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKSLHFSGHVAHLELQIRVRCDENYYSATCNKF
Gene Name JAG2 jagged 2 [ Homo sapiens ]
Official Symbol JAG2
Synonyms JAG2; jagged 2; protein jagged-2;
Gene ID 3714
mRNA Refseq NM_002226
Protein Refseq NP_002217
MIM 602570
Uniprot ID Q9Y219
Chromosome Location 14q32
Pathway Delta-Notch Signaling Pathway, organism-specific biosystem; Notch receptor binds with a ligand, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, organism-specific biosystem; Notch signaling pathway, conserved biosystem;
Function Notch binding; calcium ion binding; growth factor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JAG2 Products

Required fields are marked with *

My Review for All JAG2 Products

Required fields are marked with *

0
cart-icon
0
compare icon