Recombinant Human JAK1 protein, His-tagged
| Cat.No. : | JAK1-2667H |
| Product Overview : | Recombinant Human JAK1 protein(1080-1151 aa), fused to His tag, was expressed in E. coli. |
| Availability | July 02, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1080-1151 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEA |
| Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | JAK1 Janus kinase 1 [ Homo sapiens ] |
| Official Symbol | JAK1 |
| Synonyms | JAK1; Janus kinase 1; JAK1B; tyrosine-protein kinase JAK1; JAK1A; JTK3; |
| Gene ID | 3716 |
| mRNA Refseq | NM_002227 |
| Protein Refseq | NP_002218 |
| MIM | 147795 |
| UniProt ID | P23458 |
| ◆ Recombinant Proteins | ||
| JAK1-159H | Recombinant Human JAK1 protein, His/MBP-tagged | +Inquiry |
| JAK1-674H | Recombinant Human Janus Kinase 1, GST-tagged | +Inquiry |
| JAK1-1227H | Recombinant Human JAK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Jak1-3626M | Recombinant Mouse Jak1 Protein, Myc/DDK-tagged | +Inquiry |
| JAK1-3183H | Recombinant Human JAK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JAK1-5107HCL | Recombinant Human JAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK1 Products
Required fields are marked with *
My Review for All JAK1 Products
Required fields are marked with *
