Recombinant Human JAK1 protein, His-tagged
Cat.No. : | JAK1-2667H |
Product Overview : | Recombinant Human JAK1 protein(1080-1151 aa), fused to His tag, was expressed in E. coli. |
Availability | October 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1080-1151 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | SDSSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPDEVYQLMRKCWEFQPSNRTSFQNLIEGFEA |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | JAK1 Janus kinase 1 [ Homo sapiens ] |
Official Symbol | JAK1 |
Synonyms | JAK1; Janus kinase 1; JAK1B; tyrosine-protein kinase JAK1; JAK1A; JTK3; |
Gene ID | 3716 |
mRNA Refseq | NM_002227 |
Protein Refseq | NP_002218 |
MIM | 147795 |
UniProt ID | P23458 |
◆ Recombinant Proteins | ||
JAK1-265H | Active Recombinant Human JAK1 protein, His-tagged | +Inquiry |
JAK1-3130H | Recombinant Human JAK1 Protein (Pro32-Phe286), N-His tagged | +Inquiry |
JAK1-159H | Recombinant Human JAK1 protein, His/MBP-tagged | +Inquiry |
JAK1-56H | Recombinant Human JAK1 protein, Flag-tagged, Biotinylated | +Inquiry |
JAK1-249H | Recombinant Human JAK1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAK1-5107HCL | Recombinant Human JAK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK1 Products
Required fields are marked with *
My Review for All JAK1 Products
Required fields are marked with *