Recombinant Human JAK2 protein(841-1130 aa), C-His-tagged
| Cat.No. : | JAK2-2477H |
| Product Overview : | Recombinant Human JAK2 protein(O60674)(841-1130 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 841-1130 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM |
| Gene Name | JAK2 Janus kinase 2 [ Homo sapiens ] |
| Official Symbol | JAK2 |
| Synonyms | JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3; |
| Gene ID | 3717 |
| mRNA Refseq | NM_004972 |
| Protein Refseq | NP_004963 |
| MIM | 147796 |
| UniProt ID | O60674 |
| ◆ Recombinant Proteins | ||
| JAK2-2327R | Recombinant Rhesus monkey JAK2 Protein, His-tagged | +Inquiry |
| JAK2-336H | Active Recombinant Human JAK2 protein, GST-tagged | +Inquiry |
| JAK2-81H | Active Recombinant Human JAK2, GST-tagged | +Inquiry |
| JAK2-27H | Recombinant Human JAK2 (V617F) Protein, FLAG/Avi-tagged, Biotin-labeled | +Inquiry |
| JAK2-3128H | Recombinant Human JAK2 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK2 Products
Required fields are marked with *
My Review for All JAK2 Products
Required fields are marked with *
