Recombinant Human JAM2 Protein (29-238 aa), His-tagged
| Cat.No. : | JAM2-1428H |
| Product Overview : | Recombinant Human JAM2 Protein (29-238 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 29-238 aa |
| Description : | May play a role in the processes of lymphocyte homing to secondary lymphoid organs. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.5 kDa |
| AA Sequence : | FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | JAM2 junctional adhesion molecule 2 [ Homo sapiens ] |
| Official Symbol | JAM2 |
| Synonyms | JAM2; C21orf43; CD322; JAM B; JAMB; VE JAM; JAM-2; JAM-IT/VE-JAM; JAM-B; VEJAM; PRO245; VE-JAM; |
| Gene ID | 58494 |
| mRNA Refseq | NM_021219 |
| Protein Refseq | NP_067042 |
| MIM | 606870 |
| UniProt ID | P57087 |
| ◆ Recombinant Proteins | ||
| JAM2-7092H | Recombinant Human JAM2, His-tagged | +Inquiry |
| Jam2-7492R | Recombinant Rat Jam2 protein, hFc-tagged | +Inquiry |
| JAM2-1735R | Recombinant Rhesus Monkey JAM2 Protein, hIgG1-tagged | +Inquiry |
| JAM2-3602H | Recombinant Human JAM2 Protein (Phe29-Asn236), C-Fc tagged | +Inquiry |
| JAM2-1404C | Recombinant Chicken JAM2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JAM2-1399RCL | Recombinant Rat JAM2 cell lysate | +Inquiry |
| JAM2-2123MCL | Recombinant Mouse JAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAM2 Products
Required fields are marked with *
My Review for All JAM2 Products
Required fields are marked with *
