Recombinant Human JAM2 Protein (29-238 aa), His-tagged

• Cat.No.: JAM2-1428H
• Product Overview: Recombinant Human JAM2 Protein (29-238 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 29-238 aa
• Description: May play a role in the processes of lymphocyte homing to secondary lymphoid organs.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.5 kDa
• AA Sequence: FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: JAM2 junctional adhesion molecule 2 [ Homo sapiens ]
• Official Symbol: JAM2
• Synonyms: JAM2; C21orf43; CD322; JAM B; JAMB; VE JAM; JAM-2; JAM-IT/VE-JAM; JAM-B; VEJAM; PRO245; VE-JAM
• Gene ID: 58494
• mRNA Refseq: NM_021219
• Protein Refseq: NP_067042
• MIM: 606870
• UniProt ID: P57087