Recombinant Human JAM2 Protein (29-238 aa), His-tagged
Cat.No. : | JAM2-1428H |
Product Overview : | Recombinant Human JAM2 Protein (29-238 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cardiovascular. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 29-238 aa |
Description : | May play a role in the processes of lymphocyte homing to secondary lymphoid organs. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 25.5 kDa |
AA Sequence : | FSAPKDQQVVTAVEYQEAILACKTPKKTVSSRLEWKKLGRSVSFVYYQQTLQGDFKNRAEMIDFNIRIKNVTRSDAGKYRCEVSAPSEQGQNLEEDTVTLEVLVAPAVPSCEVPSSALSGTVVELRCQDKEGNPAPEYTWFKDGIRLLENPRLGSQSTNSSYTMNTKTGTLQFNTVSKLDTGEYSCEARNSVGYRRCPGKRMQVDDLNIS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | JAM2 junctional adhesion molecule 2 [ Homo sapiens ] |
Official Symbol | JAM2 |
Synonyms | JAM2; C21orf43; CD322; JAM B; JAMB; VE JAM; JAM-2; JAM-IT/VE-JAM; JAM-B; VEJAM; PRO245; VE-JAM; |
Gene ID | 58494 |
mRNA Refseq | NM_021219 |
Protein Refseq | NP_067042 |
MIM | 606870 |
UniProt ID | P57087 |
◆ Recombinant Proteins | ||
Jam2-1706R | Recombinant Rat Jam2 Protein, His-tagged | +Inquiry |
JAM2-1735R | Recombinant Rhesus Monkey JAM2 Protein, hIgG1-tagged | +Inquiry |
JAM2-817H | Recombinant Human JAM2 | +Inquiry |
JAM2-1734R | Recombinant Rhesus Monkey JAM2 Protein | +Inquiry |
JAM2-1227H | Recombinant Human JAM2 Protein (Tyr74-Val250), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JAM2-1399RCL | Recombinant Rat JAM2 cell lysate | +Inquiry |
JAM2-2123MCL | Recombinant Mouse JAM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAM2 Products
Required fields are marked with *
My Review for All JAM2 Products
Required fields are marked with *
0
Inquiry Basket