Recombinant Human JMJD1C Protein, His-SUMO/MYC-tagged

Cat.No. : JMJD1C-1265H
Product Overview : Recombinant Human JMJD1C protein (2274-2498aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 2274-2498 a.a.
Description : The protein encoded by this gene interacts with thyroid hormone receptors and contains a jumonji domain. It is a candidate histone demethylase and is thought to be a coactivator for key transcription factors. It plays a role in the DNA-damage response pathway by demethylating the mediator of DNA damage checkpoint 1 (MDC1) protein, and is required for the survival of acute myeloid leukemia. Mutations in this gene are associated with Rett syndrome and intellectual disability. Alternative splicing results in multiple transcript variants.
Form : Tris-based buffer, 50% glycerol.
Molecular Mass : 45.5 kDa
AA Sequence : MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVV
NILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQ
GLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVS
PEHLVESFHLTQELR
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name JMJD1C jumonji domain containing 1C [ Homo sapiens (human) ]
Official Symbol JMJD1C
Synonyms KDM3C; TRIP8; TRIP-8; JMJD1C
Gene ID 221037
mRNA Refseq NM_032776.2
Protein Refseq NP_116165.1
MIM 604503
UniProt ID Q15652

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JMJD1C Products

Required fields are marked with *

My Review for All JMJD1C Products

Required fields are marked with *

0
cart-icon