Recombinant Human JMJD1C Protein, His-SUMO/MYC-tagged
Cat.No. : | JMJD1C-1265H |
Product Overview : | Recombinant Human JMJD1C protein (2274-2498aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc&SUMO |
Protein Length : | 2274-2498 a.a. |
Description : | The protein encoded by this gene interacts with thyroid hormone receptors and contains a jumonji domain. It is a candidate histone demethylase and is thought to be a coactivator for key transcription factors. It plays a role in the DNA-damage response pathway by demethylating the mediator of DNA damage checkpoint 1 (MDC1) protein, and is required for the survival of acute myeloid leukemia. Mutations in this gene are associated with Rett syndrome and intellectual disability. Alternative splicing results in multiple transcript variants. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 45.5 kDa |
AA Sequence : | MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVV NILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQ GLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVS PEHLVESFHLTQELR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | JMJD1C jumonji domain containing 1C [ Homo sapiens (human) ] |
Official Symbol | JMJD1C |
Synonyms | KDM3C; TRIP8; TRIP-8; JMJD1C |
Gene ID | 221037 |
mRNA Refseq | NM_032776.2 |
Protein Refseq | NP_116165.1 |
MIM | 604503 |
UniProt ID | Q15652 |
◆ Recombinant Proteins | ||
JMJD1C-4380C | Recombinant Chicken JMJD1C | +Inquiry |
JMJD1C-8421M | Recombinant Mouse JMJD1C Protein | +Inquiry |
JMJD1C-4677M | Recombinant Mouse JMJD1C Protein, His (Fc)-Avi-tagged | +Inquiry |
JMJD1C-1265H | Recombinant Human JMJD1C Protein, His-SUMO/MYC-tagged | +Inquiry |
JMJD1C-3212H | Recombinant Human JMJD1C protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JMJD1C Products
Required fields are marked with *
My Review for All JMJD1C Products
Required fields are marked with *