Recombinant Human JMJD1C Protein, His-SUMO/MYC-tagged

• Cat.No.: JMJD1C-1265H
• Product Overview: Recombinant Human JMJD1C protein (2274-2498aa) was expressed in E. coli with N-terminal His-SUMO tag and C-terminal MYC tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc&SUMO
• Protein Length: 2274-2498 a.a.
• Description: The protein encoded by this gene interacts with thyroid hormone receptors and contains a jumonji domain. It is a candidate histone demethylase and is thought to be a coactivator for key transcription factors. It plays a role in the DNA-damage response pathway by demethylating the mediator of DNA damage checkpoint 1 (MDC1) protein, and is required for the survival of acute myeloid leukemia. Mutations in this gene are associated with Rett syndrome and intellectual disability. Alternative splicing results in multiple transcript variants.
• Form: Tris-based buffer, 50% glycerol.
• Molecular Mass: 45.5 kDa
• AA Sequence: MPARYEDLLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVSDVV
  NILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVDKIREFLQKISKEQ
  GLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVLPAGALHQVQNFHSCIQVTEDFVS
  PEHLVESFHLTQELR
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.

Gene Information

• Gene Name: JMJD1C jumonji domain containing 1C [ Homo sapiens (human) ]
• Official Symbol: JMJD1C
• Synonyms: KDM3C; TRIP8; TRIP-8; JMJD1C
• Gene ID: 221037
• mRNA Refseq: NM_032776.2
• Protein Refseq: NP_116165.1
• MIM: 604503
• UniProt ID: Q15652