Recombinant Human JMJD1C protein, His-tagged

• Cat.No.: JMJD1C-3212H
• Product Overview: Recombinant Human JMJD1C protein(25-138 aa), fused to His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 25-138 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: TGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSS
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: JMJD1C jumonji domain containing 1C [ Homo sapiens ]
• Official Symbol: JMJD1C
• Synonyms: JMJD1C; jumonji domain containing 1C; thyroid hormone receptor interactor 8 , TRIP8; probable JmjC domain-containing histone demethylation protein 2C; DKFZp761F0118; FLJ14374; KIAA1380; TRIP-8; TR-interacting protein 8; jumonji domain-containing protein 1C; thyroid hormone receptor interactor 8; thyroid receptor interacting protein 8; thyroid receptor-interacting protein 8; TRIP8; RP11-10C13.2
• Gene ID: 221037
• mRNA Refseq: NM_004241
• Protein Refseq: NP_004232
• MIM: 604503
• UniProt ID: Q15652