Recombinant Human JMJD1C protein, His-tagged
Cat.No. : | JMJD1C-3212H |
Product Overview : | Recombinant Human JMJD1C protein(25-138 aa), fused to His tag, was expressed in E. coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 25-138 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSS |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | JMJD1C jumonji domain containing 1C [ Homo sapiens ] |
Official Symbol | JMJD1C |
Synonyms | JMJD1C; jumonji domain containing 1C; thyroid hormone receptor interactor 8 , TRIP8; probable JmjC domain-containing histone demethylation protein 2C; DKFZp761F0118; FLJ14374; KIAA1380; TRIP-8; TR-interacting protein 8; jumonji domain-containing protein 1C; thyroid hormone receptor interactor 8; thyroid receptor interacting protein 8; thyroid receptor-interacting protein 8; TRIP8; RP11-10C13.2; |
Gene ID | 221037 |
mRNA Refseq | NM_004241 |
Protein Refseq | NP_004232 |
MIM | 604503 |
UniProt ID | Q15652 |
◆ Recombinant Proteins | ||
JMJD1C-4380C | Recombinant Chicken JMJD1C | +Inquiry |
JMJD1C-8421M | Recombinant Mouse JMJD1C Protein | +Inquiry |
JMJD1C-1265H | Recombinant Human JMJD1C Protein, His-SUMO/MYC-tagged | +Inquiry |
JMJD1C-4677M | Recombinant Mouse JMJD1C Protein, His (Fc)-Avi-tagged | +Inquiry |
JMJD1C-3212H | Recombinant Human JMJD1C protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JMJD1C Products
Required fields are marked with *
My Review for All JMJD1C Products
Required fields are marked with *