Recombinant Human JMJD1C protein, His-tagged

Cat.No. : JMJD1C-3212H
Product Overview : Recombinant Human JMJD1C protein(25-138 aa), fused to His tag, was expressed in E. coli.
Availability December 01, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 25-138 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : TGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQMTFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNTHQQQQQRSIRPNKRKGSDSS
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name JMJD1C jumonji domain containing 1C [ Homo sapiens ]
Official Symbol JMJD1C
Synonyms JMJD1C; jumonji domain containing 1C; thyroid hormone receptor interactor 8 , TRIP8; probable JmjC domain-containing histone demethylation protein 2C; DKFZp761F0118; FLJ14374; KIAA1380; TRIP-8; TR-interacting protein 8; jumonji domain-containing protein 1C; thyroid hormone receptor interactor 8; thyroid receptor interacting protein 8; thyroid receptor-interacting protein 8; TRIP8; RP11-10C13.2;
Gene ID 221037
mRNA Refseq NM_004241
Protein Refseq NP_004232
MIM 604503
UniProt ID Q15652

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JMJD1C Products

Required fields are marked with *

My Review for All JMJD1C Products

Required fields are marked with *

0
cart-icon
0
compare icon