Recombinant Human JUN protein, His&Myc-tagged
| Cat.No. : | JUN-4267H |
| Product Overview : | Recombinant Human JUN protein(P05412)(1-331aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-331aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 43.1 kDa |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSEPPVYANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF |
| Gene Name | JUN jun proto-oncogene [ Homo sapiens ] |
| Official Symbol | JUN |
| Synonyms | JUN; jun proto-oncogene; jun oncogene , v jun avian sarcoma virus 17 oncogene homolog , v jun sarcoma virus 17 oncogene homolog (avian); transcription factor AP-1; AP 1; c Jun; p39; jun oncogene; activator protein 1; proto-oncogene c-Jun; enhancer-binding protein AP1; Jun activation domain binding protein; v-jun sarcoma virus 17 oncogene homolog; v-jun avian sarcoma virus 17 oncogene homolog; AP1; AP-1; c-Jun; |
| Gene ID | 3725 |
| mRNA Refseq | NM_002228 |
| Protein Refseq | NP_002219 |
| MIM | 165160 |
| UniProt ID | P05412 |
| ◆ Recombinant Proteins | ||
| Jun-5214M | Recombinant Mouse Jun protein, His-tagged | +Inquiry |
| JUN-784H | Recombinant Human JUN protein, His-SUMO-tagged | +Inquiry |
| JUN-4856H | Recombinant Human Jun Proto-Oncogene, GST-tagged | +Inquiry |
| JUN-1498G | Recombinant Gallus gallus JUN Protein (Full Length), N-His tagged | +Inquiry |
| JUN-3146R | Recombinant Rat JUN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| JUN-5095HCL | Recombinant Human JUN 293 Cell Lysate | +Inquiry |
| JUN-355HKCL | Human JUN Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUN Products
Required fields are marked with *
My Review for All JUN Products
Required fields are marked with *



