Recombinant Human JUP protein, GST-tagged
Cat.No. : | JUP-301494H |
Product Overview : | Recombinant Human JUP (669-745 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Thr669-Ala745 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | TNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | JUP junction plakoglobin [ Homo sapiens ] |
Official Symbol | JUP |
Synonyms | JUP; junction plakoglobin; catenin (cadherin associated protein), gamma 80kDa , CTNNG; DP3; DPIII; PDGB; PKGB; catenin gamma; desmoplakin-3; gamma-catenin; desmoplakin III; catenin (cadherin-associated protein), gamma 80kDa; catenin (cadherin-associated protein), gamma (80kD); CTNNG; ARVD12; |
Gene ID | 3728 |
mRNA Refseq | NM_002230 |
Protein Refseq | NP_002221 |
MIM | 173325 |
UniProt ID | P14923 |
◆ Recombinant Proteins | ||
JUP-4638C | Recombinant Chicken JUP | +Inquiry |
JUP-3149R | Recombinant Rat JUP Protein | +Inquiry |
JUP-1234H | Recombinant Human JUP Protein, His (Fc)-Avi-tagged | +Inquiry |
JUP-27307TH | Recombinant Human JUP protein, GST-tagged | +Inquiry |
JUP-6957HF | Recombinant Full Length Human JUP Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
JUP-5094HCL | Recombinant Human JUP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JUP Products
Required fields are marked with *
My Review for All JUP Products
Required fields are marked with *