Recombinant Human JUP protein, GST-tagged

Cat.No. : JUP-301494H
Product Overview : Recombinant Human JUP (669-745 aa) protein, fused to GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : Thr669-Ala745
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : TNSLFKHDPAAWEAAQSMIPINEPYGDDMDATYRPMYSSDVPLDPLEMHMDMDGDYPIDTYSDGLRPPYPTADHMLA
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Gene Name JUP junction plakoglobin [ Homo sapiens ]
Official Symbol JUP
Synonyms JUP; junction plakoglobin; catenin (cadherin associated protein), gamma 80kDa , CTNNG; DP3; DPIII; PDGB; PKGB; catenin gamma; desmoplakin-3; gamma-catenin; desmoplakin III; catenin (cadherin-associated protein), gamma 80kDa; catenin (cadherin-associated protein), gamma (80kD); CTNNG; ARVD12;
Gene ID 3728
mRNA Refseq NM_002230
Protein Refseq NP_002221
MIM 173325
UniProt ID P14923

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All JUP Products

Required fields are marked with *

My Review for All JUP Products

Required fields are marked with *

0
cart-icon