Recombinant Human KAAG1 protein, His-tagged

• Cat.No.: KAAG1-4667H
• Product Overview: Recombinant Human KAAG1 protein(Q9UBP8)(1-84 aa), fused with N-terminal His tag, was expressed in Yeast.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 1-84 aa
• Form: For liquid formulations, the standard storage buffer consists of a Tris or PBS based solution supplemented with 5-50% glycerol. When provided as lyophilized powder, the product undergoes freeze-drying from a Tris- or PBS-based formulation containing 6% trehalose, adjusted to pH 8.0 prior to the lyophilization process.
• Molecular Mass: 11.0 kDa
• AASequence: MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEK
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL. Aliquot for long-term storage at -80°C.

Gene Information

• Gene Name: KAAG1 kidney associated antigen 1 [ Homo sapiens ]
• Official Symbol: KAAG1
• Synonyms: RU2AS
• Gene ID: 353219
• mRNA Refseq: NM_181337.3
• Protein Refseq: NP_851854.1
• MIM: 608211
• UniProt ID: Q9UBP8