Recombinant Human KAAG1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KAAG1-5942H |
Product Overview : | KAAG1 MS Standard C13 and N15-labeled recombinant protein (NP_851854) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | KAAG1 (Kidney Associated Antigen 1) is a Protein Coding gene. Diseases associated with KAAG1 include Sclerosing Cholangitis, Neonatal and Deafness, Autosomal Recessive 66. |
Molecular Mass : | 8.8 kDa |
AA Sequence : | MDDDAAPRVEGVPVAVHKHALHDGLRQVAGPGAAAAHLPRWPPPQLAASRREAPPLSQRPHRTQGAGSPPETNEKLTNPQVKEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KAAG1 kidney associated antigen 1 [ Homo sapiens (human) ] |
Official Symbol | KAAG1 |
Synonyms | KAAG1; kidney associated antigen 1; RU2AS; kidney-associated antigen 1; RU2 antisense gene protein |
Gene ID | 353219 |
mRNA Refseq | NM_181337 |
Protein Refseq | NP_851854 |
MIM | 608211 |
UniProt ID | Q9UBP8 |
◆ Recombinant Proteins | ||
KAAG1-3501H | Recombinant Human KAAG1, His-tagged | +Inquiry |
KAAG1-149H | Recombinant Human KAAG1 Protein, MYC/DDK-tagged | +Inquiry |
KAAG1-5942H | Recombinant Human KAAG1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KAAG1 Products
Required fields are marked with *
My Review for All KAAG1 Products
Required fields are marked with *
0
Inquiry Basket