Recombinant Human KAT2A protein, His-tagged
| Cat.No. : | KAT2A-5764H |
| Product Overview : | Recombinant Human KAT2A protein(537-837 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 537-837 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | EYIARLVFDPKHKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHNILYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKELKDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | KAT2A K(lysine) acetyltransferase 2A [ Homo sapiens ] |
| Official Symbol | KAT2A |
| Synonyms | KAT2A; K(lysine) acetyltransferase 2A; GCN5 general control of amino acid synthesis 5 like 2 (yeast) , GCN5L2; histone acetyltransferase KAT2A; GCN5; PCAF b; STAF97; hsGCN5; lysine acetyltransferase 2A; histone acetyltransferase GCN5; general control of amino acid synthesis protein 5-like 2; General control of amino acid synthesis, yeast, homolog-like 2; GCN5 (general control of amino-acid synthesis, yeast, homolog)-like 2; hGCN5; GCN5L2; PCAF-b; MGC102791; |
| Gene ID | 2648 |
| mRNA Refseq | NM_021078 |
| Protein Refseq | NP_066564 |
| MIM | 602301 |
| UniProt ID | Q92830 |
| ◆ Recombinant Proteins | ||
| KAT2A-5765H | Recombinant Human KAT2A protein, GST-tagged | +Inquiry |
| KAT2A-2132H | Recombinant Human KAT2A protein, GST-tagged | +Inquiry |
| KAT2A-5764H | Recombinant Human KAT2A protein, His-tagged | +Inquiry |
| KAT2A-058H | Recombinant Human KAT2A Protein, His-tagged | +Inquiry |
| KAT2A-2352H | Recombinant Human KAT2A Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KAT2A-290HCL | Recombinant Human KAT2A HEK293T cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KAT2A Products
Required fields are marked with *
My Review for All KAT2A Products
Required fields are marked with *
