Recombinant Human KAT7 Protein, GST-tagged

Cat.No. : KAT7-5864H
Product Overview : Human MYST2 full-length ORF ( NP_008998.1, 1 a.a. - 611 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed. [provided by RefSeq, Oct 2016]
Molecular Mass : 36.41 kDa
AA Sequence : SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KAT7 lysine acetyltransferase 7 [ Homo sapiens (human) ]
Official Symbol KAT7
Synonyms KAT7; lysine acetyltransferase 7; HBO1; HBOA; MYST2; ZC2HC7; histone acetyltransferase KAT7; K(lysine) acetyltransferase 7; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2; MYST histone acetyltransferase 2; histone acetyltransferase MYST2; histone acetyltransferase binding to ORC1; EC 2.3.1.48
Gene ID 11143
mRNA Refseq NM_001199155
Protein Refseq NP_001186084
MIM 609880
UniProt ID O95251

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KAT7 Products

Required fields are marked with *

My Review for All KAT7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon