Recombinant Human KAT7 Protein, GST-tagged
Cat.No. : | KAT7-5864H |
Product Overview : | Human MYST2 full-length ORF ( NP_008998.1, 1 a.a. - 611 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is part of the multimeric HBO1 complex, which possesses histone H4-specific acetyltransferase activity. This activity is required for functional replication origins and is involved in transcriptional activation of some genes. In both cases, the acetylation of histone H4 helps unfold chromatin so that the DNA can be accessed and replicated or transcribed. [provided by RefSeq, Oct 2016] |
Molecular Mass : | 36.41 kDa |
AA Sequence : | SDLGLISYRSYWKEVLLRYLHNFQGKEISIKEISQETAVNPVDIVSTLQALQMLKYWKGKHLVLKRQDLIDEWIAKEAKRSNSNKTMDPSCLKWTPPKGT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KAT7 lysine acetyltransferase 7 [ Homo sapiens (human) ] |
Official Symbol | KAT7 |
Synonyms | KAT7; lysine acetyltransferase 7; HBO1; HBOA; MYST2; ZC2HC7; histone acetyltransferase KAT7; K(lysine) acetyltransferase 7; MOZ, YBF2/SAS3, SAS2 and TIP60 protein 2; MYST histone acetyltransferase 2; histone acetyltransferase MYST2; histone acetyltransferase binding to ORC1; EC 2.3.1.48 |
Gene ID | 11143 |
mRNA Refseq | NM_001199155 |
Protein Refseq | NP_001186084 |
MIM | 609880 |
UniProt ID | O95251 |
◆ Recombinant Proteins | ||
KAT7-6957H | Recombinant Human KAT7 protein, Flag-tagged | +Inquiry |
KAT7-1601H | Recombinant Human K(Lysine) Acetyltransferase 7, GST-tagged | +Inquiry |
KAT7-1200H | Recombinant Human KAT7 Protein (1-214 aa), GST-tagged | +Inquiry |
KAT7-5864H | Recombinant Human KAT7 Protein, GST-tagged | +Inquiry |
KAT7-3157R | Recombinant Rat KAT7 Protein | +Inquiry |
◆ Native Proteins | ||
KAT7-01HFL | Active Recombinant Full Length Human KAT7 Protein, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KAT7-3999HCL | Recombinant Human MYST2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KAT7 Products
Required fields are marked with *
My Review for All KAT7 Products
Required fields are marked with *
0
Inquiry Basket