Recombinant Human KCNIP4 protein, His-tagged
Cat.No. : | KCNIP4-3359H |
Product Overview : | Recombinant Human KCNIP4 protein(1-250 aa), fused to His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-250 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MNVRRVESISAQLEEASSTGGFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQNSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVI |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | KCNIP4 Kv channel interacting protein 4 [ Homo sapiens ] |
Official Symbol | KCNIP4 |
Synonyms | KCNIP4; Kv channel interacting protein 4; Kv channel-interacting protein 4; CALP; KCHIP4; MGC44947; calsenilin-like protein; potassium channel interacting protein 4; potassium channel-interacting protein 4; a-type potassium channel modulatory protein 4; |
Gene ID | 80333 |
mRNA Refseq | NM_001035003 |
Protein Refseq | NP_001030175 |
MIM | 608182 |
UniProt ID | Q6PIL6 |
◆ Recombinant Proteins | ||
KCNIP4-251H | Recombinant Human KCNIP4, GST-tagged | +Inquiry |
KCNIP4-2164H | Recombinant Human KCNIP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCNIP4-3359H | Recombinant Human KCNIP4 protein, His-tagged | +Inquiry |
KCNIP4-6124C | Recombinant Chicken KCNIP4 | +Inquiry |
KCNIP4-193H | Recombinant Human KCNIP4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNIP4-5050HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
KCNIP4-5052HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
KCNIP4-5051HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNIP4 Products
Required fields are marked with *
My Review for All KCNIP4 Products
Required fields are marked with *