Recombinant Human KCNIP4 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | KCNIP4-2164H |
Product Overview : | KCNIP4 MS Standard C13 and N15-labeled recombinant protein (NP_671712) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the family of voltage-gated potassium (Kv) channel-interacting proteins (KCNIPs), which belong to the recoverin branch of the EF-hand superfamily. Members of the KCNIP family are small calcium binding proteins. They all have EF-hand-like domains, and differ from each other in the N-terminus. They are integral subunit components of native Kv4 channel complexes. They may regulate A-type currents, and hence neuronal excitability, in response to changes in intracellular calcium. This protein member also interacts with presenilin. Multiple alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. |
Molecular Mass : | 26.3 kDa |
AA Sequence : | MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLEDSVEDELEMATVRHRPEALELLEAQSKFTKKELQILYRGFKNECPSGVVNEETFKEIYSQFFPQGDSTTYAHFLFNAFDTDHNGAVSFEDFIKGLSILLRGTVQEKLNWAFNLYDINKDGYITKEEMLDIMKAIYDMMGKCTYPVLKEDAPRQHVETFFQKMDKNKDGVVTIDEFIESCQKDENIMRSMQLFENVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | KCNIP4 Kv channel interacting protein 4 [ Homo sapiens (human) ] |
Official Symbol | KCNIP4 |
Synonyms | KCNIP4; Kv channel interacting protein 4; Kv channel-interacting protein 4; CALP; KCHIP4; MGC44947; calsenilin-like protein; potassium channel interacting protein 4; potassium channel-interacting protein 4; a-type potassium channel modulatory protein 4; |
Gene ID | 80333 |
mRNA Refseq | NM_147183 |
Protein Refseq | NP_671712 |
MIM | 608182 |
UniProt ID | Q6PIL6 |
◆ Recombinant Proteins | ||
KCNIP4-3359H | Recombinant Human KCNIP4 protein, His-tagged | +Inquiry |
KCNIP4-2164H | Recombinant Human KCNIP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCNIP4-3193R | Recombinant Rat KCNIP4 Protein | +Inquiry |
KCNIP4-193H | Recombinant Human KCNIP4 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
KCNIP4-2849R | Recombinant Rat KCNIP4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNIP4-5050HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
KCNIP4-5052HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
KCNIP4-5051HCL | Recombinant Human KCNIP4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNIP4 Products
Required fields are marked with *
My Review for All KCNIP4 Products
Required fields are marked with *
0
Inquiry Basket