Recombinant Human KCNJ10 protein(231-370 aa), C-His-tagged

Cat.No. : KCNJ10-2809H
Product Overview : Recombinant Human KCNJ10 protein(P78508)(231-370 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 231-370 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : LNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGS
Gene Name KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ]
Official Symbol KCNJ10
Synonyms KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; inward rectifier K+ channel KIR1.2; inward rectifier K(+) channel Kir1.2; ATP-dependent inwardly rectifying potassium channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN;
Gene ID 3766
mRNA Refseq NM_002241
Protein Refseq NP_002232
MIM 602208
UniProt ID P78508

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ10 Products

Required fields are marked with *

My Review for All KCNJ10 Products

Required fields are marked with *

0
cart-icon
0
compare icon