Recombinant Human KCNJ10 protein(231-370 aa), C-His-tagged

• Cat.No.: KCNJ10-2809H
• Product Overview: Recombinant Human KCNJ10 protein(P78508)(231-370 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 231-370 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: LNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGS

Gene Information

• Gene Name: KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ]
• Official Symbol: KCNJ10
• Synonyms: KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; inward rectifier K+ channel KIR1.2; inward rectifier K(+) channel Kir1.2; ATP-dependent inwardly rectifying potassium channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN
• Gene ID: 3766
• mRNA Refseq: NM_002241
• Protein Refseq: NP_002232
• MIM: 602208
• UniProt ID: P78508