Recombinant Human KCNJ10 protein, His/SUMO-tagged

Cat.No. : KCNJ10-2596H
Product Overview : Recombinant Human KCNJ10(165-379aa) fused with His/SUMO tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 165-379aa
Description : May be responsible for potassium buffering action of glial cells in the brain. Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of Extracellular domain potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages. The inward rectification is mainly due to the blockage of outward current by internal magnesium. Can be blocked by Extracellular domain barium and cesium .
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 39.8kDa
AA Sequence : FLAKIARPKKRAETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Gene Name KCNJ10 potassium inwardly-rectifying channel, subfamily J, member 10 [ Homo sapiens ]
Official Symbol KCNJ10
Synonyms KCNJ10; potassium inwardly-rectifying channel, subfamily J, member 10; ATP-sensitive inward rectifier potassium channel 10; Kir1.2; Kir4.1; inward rectifier K+ channel KIR1.2; inward rectifier K(+) channel Kir1.2; ATP-dependent inwardly rectifying potassium channel Kir4.1; potassium channel, inwardly rectifying subfamily J member 10; glial ATP-dependent inwardly rectifying potassium channel KIR4.1; KIR1.2; KIR4.1; SESAME; BIRK-10; KCNJ13-PEN;
Gene ID 3766
mRNA Refseq NM_002241
Protein Refseq NP_002232
MIM 602208
UniProt ID P78508
Chromosome Location 1q23.2
Pathway Activation of G protein gated Potassium channels, organism-specific biosystem; Activation of GABAB receptors, organism-specific biosystem; G protein gated Potassium channels, organism-specific biosystem; GABA B receptor activation, organism-specific biosystem; GABA receptor activation, organism-specific biosystem; Gastric acid secretion, organism-specific biosystem; Gastric acid secretion, conserved biosystem;
Function ATP binding; ATP-activated inward rectifier potassium channel activity; identical protein binding; nucleotide binding; potassium channel activity; protein binding; voltage-gated ion channel activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNJ10 Products

Required fields are marked with *

My Review for All KCNJ10 Products

Required fields are marked with *

0
cart-icon
0
compare icon