Recombinant Human KCNJ6 protein, GST-tagged

• Cat.No.: KCNJ6-6755H
• Product Overview: Recombinant Human KCNJ6 protein(351-423 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: GST
• Protein Length: 351-423 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV
• Purity: 85%, by SDS-PAGE.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: KCNJ6 potassium inwardly-rectifying channel, subfamily J, member 6 [ Homo sapiens ]
• Official Symbol: KCNJ6
• Synonyms: KCNJ6; potassium inwardly-rectifying channel, subfamily J, member 6; KCNJ7; G protein-activated inward rectifier potassium channel 2; BIR1; GIRK2; hiGIRK2; KATP2; Kir3.2; inward rectifier K(+) channel Kir3.2; inward rectifier potassium channel KIR3.2; potassium channel, inwardly rectifying subfamily J member 6; GIRK-2; KATP-2; KIR3.2; MGC126596
• mRNA Refseq: NM_002240
• Protein Refseq: NP_002231
• MIM: 600877
• UniProt ID: P48051
• Gene ID: 3763