Recombinant Human KCNJ6 protein, GST-tagged
Cat.No. : | KCNJ6-6755H |
Product Overview : | Recombinant Human KCNJ6 protein(351-423 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | GST |
Protein Length : | 351-423 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | YNSFHETYETSTPSLSAKELAELASRAELPLSWSVSSKLNQHAELETEEEEKNLEEQTERNGDVANLENESKV |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | KCNJ6 potassium inwardly-rectifying channel, subfamily J, member 6 [ Homo sapiens ] |
Official Symbol | KCNJ6 |
Synonyms | KCNJ6; potassium inwardly-rectifying channel, subfamily J, member 6; KCNJ7; G protein-activated inward rectifier potassium channel 2; BIR1; GIRK2; hiGIRK2; KATP2; Kir3.2; inward rectifier K(+) channel Kir3.2; inward rectifier potassium channel KIR3.2; potassium channel, inwardly rectifying subfamily J member 6; GIRK-2; KATP-2; KIR3.2; MGC126596; |
mRNA Refseq | NM_002240 |
Protein Refseq | NP_002231 |
MIM | 600877 |
UniProt ID | P48051 |
Gene ID | 3763 |
◆ Recombinant Proteins | ||
KCNJ6-6755H | Recombinant Human KCNJ6 protein, GST-tagged | +Inquiry |
KCNJ6-355H | Recombinant Human KCNJ6 Protein, MYC/DDK-tagged | +Inquiry |
Kcnj6-1260M | Recombinant Mouse Kcnj6 Protein, MYC/DDK-tagged | +Inquiry |
KCNJ6-259H | Recombinant Human KCNJ6, GST-tagged | +Inquiry |
KCNJ6-1559H | Recombinant Human KCNJ6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KCNJ6 Products
Required fields are marked with *
My Review for All KCNJ6 Products
Required fields are marked with *