Recombinant Human KCNMA1 Protein (411-560 aa), His-HPC4-tagged
Cat.No. : | KCNMA1-2703H |
Product Overview : | Recombinant Human KCNMA1 Protein (411-560 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-HPC4 tag at the C-terminal. Research Area: Cancer. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&HPC4 |
Protein Length : | 411-560 aa |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 20.0 kDa |
AA Sequence : | VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [ Homo sapiens ] |
Official Symbol | KCNMA1 |
Synonyms | KCNMA1; SLO; KCa1.1; mSLO1; hSlo; k(VCA)alpha; slo homolog; slowpoke homolog; BKTM; SLO1; MaxiK; SAKCA; SLO-ALPHA; bA205K10.1; MGC71881; DKFZp686K1437; |
Gene ID | 3778 |
mRNA Refseq | NM_001014797 |
Protein Refseq | NP_001014797 |
MIM | 600150 |
UniProt ID | Q12791 |
◆ Recombinant Proteins | ||
KCNMA1-2364R | Recombinant Rhesus monkey KCNMA1 Protein, His-tagged | +Inquiry |
KCNMA1-2870R | Recombinant Rat KCNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNMA1-2703H | Recombinant Human KCNMA1 Protein (411-560 aa), His-HPC4-tagged | +Inquiry |
KCNMA1-2185R | Recombinant Rhesus Macaque KCNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KCNMA1-5797C | Recombinant Chicken KCNMA1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNMA1-5028HCL | Recombinant Human KCNMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNMA1 Products
Required fields are marked with *
My Review for All KCNMA1 Products
Required fields are marked with *
0
Inquiry Basket