Recombinant Human KCNMA1 Protein (411-560 aa), His-HPC4-tagged

• Cat.No.: KCNMA1-2703H
• Product Overview: Recombinant Human KCNMA1 Protein (411-560 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-HPC4 tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His&HPC4
• Protein Length: 411-560 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 20.0 kDa
• AA Sequence: VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [ Homo sapiens ]
• Official Symbol: KCNMA1
• Synonyms: KCNMA1; SLO; KCa1.1; mSLO1; hSlo; k(VCA)alpha; slo homolog; slowpoke homolog; BKTM; SLO1; MaxiK; SAKCA; SLO-ALPHA; bA205K10.1; MGC71881; DKFZp686K1437
• Gene ID: 3778
• mRNA Refseq: NM_001014797
• Protein Refseq: NP_001014797
• MIM: 600150
• UniProt ID: Q12791