Recombinant Human KCNMA1 Protein (411-560 aa), His-HPC4-tagged

Cat.No. : KCNMA1-2703H
Product Overview : Recombinant Human KCNMA1 Protein (411-560 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-HPC4 tag at the C-terminal. Research Area: Cancer. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&HPC4
Protein Length : 411-560 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 20.0 kDa
AA Sequence : VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [ Homo sapiens ]
Official Symbol KCNMA1
Synonyms KCNMA1; SLO; KCa1.1; mSLO1; hSlo; k(VCA)alpha; slo homolog; slowpoke homolog; BKTM; SLO1; MaxiK; SAKCA; SLO-ALPHA; bA205K10.1; MGC71881; DKFZp686K1437;
Gene ID 3778
mRNA Refseq NM_001014797
Protein Refseq NP_001014797
MIM 600150
UniProt ID Q12791

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNMA1 Products

Required fields are marked with *

My Review for All KCNMA1 Products

Required fields are marked with *

0
cart-icon
0
compare icon