Recombinant Human KCNMA1 protein

Cat.No. : KCNMA1-4378H
Product Overview : Recombinant Human KCNMA1 protein(Q12791)(411-560aa), was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 411-560aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 17.2 kDa
AA Sequence : VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [ Homo sapiens ]
Official Symbol KCNMA1
Synonyms KCNMA1; potassium large conductance calcium-activated channel, subfamily M, alpha member 1; SLO; calcium-activated potassium channel subunit alpha-1; BK channel alpha subunit; KCa1.1; mSLO1; hSlo; k(VCA)alpha; slo homolog; slowpoke homolog; BKCA alpha subunit; maxi-K channel HSLO; stretch-activated Kca channel; calcium-activated potassium channel, subfamily M subunit alpha-1; BKTM; SLO1; MaxiK; SAKCA; SLO-ALPHA; bA205K10.1; MGC71881; DKFZp686K1437;
Gene ID 3778
mRNA Refseq NM_001014797
Protein Refseq NP_001014797
MIM 600150
UniProt ID Q12791

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KCNMA1 Products

Required fields are marked with *

My Review for All KCNMA1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon