Recombinant Human KCNMA1 protein
Cat.No. : | KCNMA1-4378H |
Product Overview : | Recombinant Human KCNMA1 protein(Q12791)(411-560aa), was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 411-560aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 17.2 kDa |
AA Sequence : | VVCGHITLESVSNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKIESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWNWKEGDDAICLAELKLGFIA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | KCNMA1 potassium large conductance calcium-activated channel, subfamily M, alpha member 1 [ Homo sapiens ] |
Official Symbol | KCNMA1 |
Synonyms | KCNMA1; potassium large conductance calcium-activated channel, subfamily M, alpha member 1; SLO; calcium-activated potassium channel subunit alpha-1; BK channel alpha subunit; KCa1.1; mSLO1; hSlo; k(VCA)alpha; slo homolog; slowpoke homolog; BKCA alpha subunit; maxi-K channel HSLO; stretch-activated Kca channel; calcium-activated potassium channel, subfamily M subunit alpha-1; BKTM; SLO1; MaxiK; SAKCA; SLO-ALPHA; bA205K10.1; MGC71881; DKFZp686K1437; |
Gene ID | 3778 |
mRNA Refseq | NM_001014797 |
Protein Refseq | NP_001014797 |
MIM | 600150 |
UniProt ID | Q12791 |
◆ Recombinant Proteins | ||
KCNMA1-2364R | Recombinant Rhesus monkey KCNMA1 Protein, His-tagged | +Inquiry |
KCNMA1-2703H | Recombinant Human KCNMA1 Protein (411-560 aa), His-HPC4-tagged | +Inquiry |
KCNMA1-4378H | Recombinant Human KCNMA1 protein | +Inquiry |
KCNMA1-3214R | Recombinant Rat KCNMA1 Protein | +Inquiry |
KCNMA1-2870R | Recombinant Rat KCNMA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNMA1-5028HCL | Recombinant Human KCNMA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCNMA1 Products
Required fields are marked with *
My Review for All KCNMA1 Products
Required fields are marked with *
0
Inquiry Basket