Recombinant Human KCNQ3 protein, GST-tagged

• Cat.No.: KCNQ3-5733H
• Product Overview: Recombinant Human KCNQ3 protein(379-517 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 379-517 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: PNRIDLVATWRFYESVVSFPFFRKEQLEAASSQKLGLLDRVRLSNPRGSNTKGKLFTPLNVDAIEESPSKEPKPVGLNNKERFRTAFRMKAYAFWQSSEDAGTGDPMAEDRGYGNDFPIEDMIPTLKAAIRAVRILQFR
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: KCNQ3 potassium voltage-gated channel, KQT-like subfamily, member 3 [ Homo sapiens ]
• Official Symbol: KCNQ3
• Synonyms: KCNQ3; potassium voltage-gated channel, KQT-like subfamily, member 3; EBN2; potassium voltage-gated channel subfamily KQT member 3; Kv7.3; potassium channel subunit alpha KvLQT3; voltage-gated potassium channel subunit Kv7.3; potassium channel, voltage-gated, subfamily Q, member 3; BFNC2; KV7.3; FLJ37386; FLJ38392; DKFZp686C0248
• Gene ID: 3786
• mRNA Refseq: NM_001204824
• Protein Refseq: NP_001191753
• MIM: 602232
• UniProt ID: O43525