Recombinant Human KCTD15 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: KCTD15-1804H
• Product Overview: KCTD15 MS Standard C13 and N15-labeled recombinant protein (NP_001123466) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: During embryonic development, interferes with neural crest formation. Inhibits AP2 transcriptional activity by interaction with its activation domain.
• Molecular Mass: 31.8 kDa
• AA Sequence: MPHRKERPSGSSLHTHGSTGTAEGGNMSRLSLTRSPVSPLAAQGIPLPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHYFIDRDGEIFRYVLSFLRTSKLLLPDDFKDFSLLYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLVVRVTPDLGERIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFPLNGYCRLNSVQVLERLFQRGFSVAASCGGGVDSSQFSEYVLCREERRPQPTPTAVRIKQEPLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: KCTD15 potassium channel tetramerisation domain containing 15 [ Homo sapiens (human) ]
• Official Symbol: KCTD15
• Synonyms: KCTD15; potassium channel tetramerisation domain containing 15; BTB/POZ domain-containing protein KCTD15; MGC25497; MGC2628
• Gene ID: 79047
• mRNA Refseq: NM_001129994
• Protein Refseq: NP_001123466
• MIM: 615240
• UniProt ID: Q96SI1