Recombinant Human KCTD4
Cat.No. : | KCTD4-28457TH |
Product Overview : | Recombinant Full Length Human KCTD4 produced in Saccharomyces cerevisiae; 259 amino acids, MWt 30kDa. Protein is tagged with 26 kDa proprietary tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Tag : | Non |
Description : | KCTD4 contains a potassium channel tetramerisation domain. The N terminal, cytoplasmic tetramerisation domain (T1) of voltage-gated potassium channels encodes molecular determinants for subfamily specific assembly of alpha subunits into functional tetrameric channels. The specific function of KCTD4 is unknown. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MERKINRREKEKEYEGKHNSLEDTDQGKNCKSTLMTLNVG GYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYF IDRDGLLFRHVLNFLRNGELLLPEGFRENQLLAQEAEFFQLKGLAEEVKSRWEKEQLTPRETTFLEITDNHDRSQGLR IFCNAPDFISKIKSRIVLVSKSRLDGFPEEFSISSNII QFKYFIKSENGTRLVLKEDNTFVCTLETLKFEAIMMALKCGFRLLTSLDCSKGSIVHSDALHFIK |
Full Length : | Full L. |
Gene Name | KCTD4 potassium channel tetramerisation domain containing 4 [ Homo sapiens ] |
Official Symbol | KCTD4 |
Synonyms | KCTD4; potassium channel tetramerisation domain containing 4; BTB/POZ domain-containing protein KCTD4; bA321C24.3; |
Gene ID | 386618 |
mRNA Refseq | NM_198404 |
Protein Refseq | NP_940686 |
Uniprot ID | Q8WVF5 |
Chromosome Location | 13q14.12-q14.13 |
Function | voltage-gated potassium channel activity; |
◆ Recombinant Proteins | ||
KCTD4-339H | Recombinant Human potassium channel tetramerization domain containing 4, His-tagged | +Inquiry |
Kctd4-3673M | Recombinant Mouse Kctd4 Protein, Myc/DDK-tagged | +Inquiry |
KCTD4-4263C | Recombinant Chicken KCTD4 | +Inquiry |
KCTD4-28457TH | Recombinant Human KCTD4 | +Inquiry |
KCTD4-441Z | Recombinant Zebrafish KCTD4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD4-893HCL | Recombinant Human KCTD4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCTD4 Products
Required fields are marked with *
My Review for All KCTD4 Products
Required fields are marked with *
0
Inquiry Basket